Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168M313

Protein Details
Accession A0A168M313    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
544-573KKDPNGVHVKKPKTKKKRATLYPKKMDPNVBasic
581-607IPKYERSTFRMKGKNKKALNKGPQGVSHydrophilic
646-667STPTPAKSAASKKKKGKGKNRKBasic
NLS Segment(s)
PositionSequence
544-564KKDPNGVHVKKPKTKKKRATL
591-597MKGKNKK
651-667AKSAASKKKKGKGKNRK
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 9.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013699  Signal_recog_part_SRP72_RNA-bd  
IPR026270  SRP72  
IPR031545  SRP_TPR-like  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF08492  SRP72  
PF17004  SRP_TPR_like  
PF13432  TPR_16  
PF13181  TPR_8  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MASATKEQQITQLFTELKKTVDEYDDERSLEICDKLIKLNPEDQLTLQCKVVTLIRLEKYKDALTMIARQFRNSDIDLSYEKIYCYYRTNQLAPAMELLQELKAKNASNDPSLLYLEAQLLYSQGQFEKAVQVYESLLKSSDKNSNLYDEIQVNLLAAKAGLLFSTNNKAAVKDKAELKESADLYEVAYNAASVYLARGDVKKAQEQLELAHKQCSDRSQGMSKEEQEEELAVISTQLGYTYQLQGRANDAMKIYRQLLNSSDVTVAAVVSNNVVALDQGKNTEEAAKHLKTATSKEADVKLKNYQKRVIHMNESLLQLYSHKYSACRDQAQKLIDKYPDNDNLYLILASATHHQHKAAKAVEELKKYAEKKPASLAIRFATIQLQLLESQPAAALSTLESYLATVKGDKSSYYKPALIALLVWLYEQTGQSEKAMETLDEASSVWKNDASFTSTAAPTSTIKQTAAFKLKTGRYQDAVVDYEQLVKADPSDAQAIAGLIAAYAHVDPKKAEQYGNALPAITLSHLDVATLEKIVPGVKRGYVKKDPNGVHVKKPKTKKKRATLYPKKMDPNVQPDPERWIPKYERSTFRMKGKNKKALNKGPQGVSMEGGGIGGTGSANIGGKKAASSTAAAAQSPEPVKEKAVSTPTPAKSAASKKKKGKGKNRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.32
4 0.29
5 0.27
6 0.27
7 0.24
8 0.26
9 0.28
10 0.26
11 0.32
12 0.34
13 0.33
14 0.31
15 0.27
16 0.26
17 0.26
18 0.23
19 0.17
20 0.18
21 0.19
22 0.22
23 0.27
24 0.3
25 0.3
26 0.36
27 0.39
28 0.39
29 0.39
30 0.37
31 0.4
32 0.39
33 0.37
34 0.32
35 0.27
36 0.24
37 0.24
38 0.27
39 0.21
40 0.22
41 0.28
42 0.32
43 0.37
44 0.39
45 0.4
46 0.41
47 0.39
48 0.36
49 0.3
50 0.27
51 0.26
52 0.32
53 0.34
54 0.38
55 0.37
56 0.37
57 0.37
58 0.36
59 0.37
60 0.3
61 0.28
62 0.21
63 0.24
64 0.25
65 0.26
66 0.26
67 0.22
68 0.2
69 0.2
70 0.21
71 0.2
72 0.23
73 0.26
74 0.32
75 0.37
76 0.4
77 0.41
78 0.44
79 0.44
80 0.4
81 0.37
82 0.29
83 0.23
84 0.21
85 0.18
86 0.15
87 0.16
88 0.15
89 0.15
90 0.17
91 0.18
92 0.2
93 0.26
94 0.27
95 0.26
96 0.28
97 0.26
98 0.25
99 0.25
100 0.23
101 0.17
102 0.15
103 0.13
104 0.12
105 0.11
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.08
112 0.1
113 0.1
114 0.11
115 0.16
116 0.16
117 0.16
118 0.15
119 0.15
120 0.15
121 0.19
122 0.19
123 0.14
124 0.15
125 0.15
126 0.16
127 0.2
128 0.26
129 0.23
130 0.26
131 0.27
132 0.3
133 0.31
134 0.31
135 0.3
136 0.24
137 0.22
138 0.19
139 0.18
140 0.13
141 0.12
142 0.1
143 0.07
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.05
150 0.06
151 0.08
152 0.14
153 0.15
154 0.17
155 0.17
156 0.19
157 0.21
158 0.26
159 0.27
160 0.26
161 0.32
162 0.33
163 0.36
164 0.35
165 0.35
166 0.35
167 0.32
168 0.28
169 0.23
170 0.2
171 0.18
172 0.19
173 0.16
174 0.1
175 0.09
176 0.08
177 0.07
178 0.06
179 0.05
180 0.03
181 0.04
182 0.04
183 0.05
184 0.07
185 0.07
186 0.1
187 0.15
188 0.18
189 0.21
190 0.24
191 0.26
192 0.26
193 0.26
194 0.27
195 0.31
196 0.32
197 0.28
198 0.29
199 0.27
200 0.26
201 0.28
202 0.28
203 0.25
204 0.24
205 0.27
206 0.29
207 0.32
208 0.35
209 0.37
210 0.36
211 0.34
212 0.31
213 0.28
214 0.22
215 0.19
216 0.16
217 0.12
218 0.1
219 0.06
220 0.05
221 0.05
222 0.04
223 0.04
224 0.04
225 0.04
226 0.05
227 0.07
228 0.11
229 0.12
230 0.17
231 0.18
232 0.18
233 0.2
234 0.22
235 0.22
236 0.19
237 0.19
238 0.16
239 0.16
240 0.18
241 0.18
242 0.18
243 0.18
244 0.18
245 0.19
246 0.21
247 0.21
248 0.2
249 0.17
250 0.13
251 0.13
252 0.11
253 0.09
254 0.05
255 0.05
256 0.04
257 0.04
258 0.04
259 0.03
260 0.03
261 0.03
262 0.03
263 0.05
264 0.05
265 0.06
266 0.07
267 0.07
268 0.08
269 0.08
270 0.12
271 0.1
272 0.13
273 0.18
274 0.18
275 0.18
276 0.19
277 0.2
278 0.19
279 0.22
280 0.23
281 0.2
282 0.2
283 0.23
284 0.28
285 0.3
286 0.3
287 0.29
288 0.33
289 0.38
290 0.41
291 0.41
292 0.42
293 0.4
294 0.42
295 0.47
296 0.43
297 0.4
298 0.38
299 0.36
300 0.33
301 0.31
302 0.28
303 0.21
304 0.17
305 0.13
306 0.13
307 0.12
308 0.09
309 0.09
310 0.09
311 0.11
312 0.18
313 0.22
314 0.26
315 0.28
316 0.3
317 0.35
318 0.36
319 0.39
320 0.33
321 0.32
322 0.3
323 0.28
324 0.27
325 0.27
326 0.31
327 0.29
328 0.27
329 0.24
330 0.21
331 0.2
332 0.18
333 0.13
334 0.07
335 0.05
336 0.05
337 0.08
338 0.09
339 0.11
340 0.11
341 0.12
342 0.16
343 0.17
344 0.22
345 0.21
346 0.2
347 0.2
348 0.28
349 0.31
350 0.3
351 0.29
352 0.26
353 0.29
354 0.3
355 0.33
356 0.34
357 0.3
358 0.3
359 0.33
360 0.38
361 0.36
362 0.35
363 0.32
364 0.25
365 0.26
366 0.24
367 0.21
368 0.15
369 0.12
370 0.12
371 0.1
372 0.1
373 0.08
374 0.09
375 0.09
376 0.07
377 0.07
378 0.06
379 0.06
380 0.05
381 0.05
382 0.04
383 0.04
384 0.05
385 0.05
386 0.05
387 0.05
388 0.05
389 0.06
390 0.06
391 0.06
392 0.06
393 0.07
394 0.09
395 0.1
396 0.1
397 0.14
398 0.17
399 0.22
400 0.24
401 0.25
402 0.23
403 0.25
404 0.24
405 0.2
406 0.16
407 0.12
408 0.09
409 0.08
410 0.07
411 0.05
412 0.05
413 0.06
414 0.06
415 0.07
416 0.08
417 0.09
418 0.09
419 0.11
420 0.11
421 0.11
422 0.12
423 0.1
424 0.1
425 0.11
426 0.1
427 0.09
428 0.09
429 0.09
430 0.1
431 0.11
432 0.09
433 0.09
434 0.09
435 0.11
436 0.12
437 0.14
438 0.13
439 0.14
440 0.17
441 0.16
442 0.16
443 0.15
444 0.15
445 0.13
446 0.16
447 0.17
448 0.15
449 0.15
450 0.18
451 0.21
452 0.27
453 0.33
454 0.3
455 0.29
456 0.36
457 0.39
458 0.42
459 0.44
460 0.41
461 0.35
462 0.37
463 0.36
464 0.32
465 0.3
466 0.24
467 0.21
468 0.17
469 0.18
470 0.16
471 0.14
472 0.11
473 0.1
474 0.1
475 0.09
476 0.09
477 0.09
478 0.1
479 0.1
480 0.1
481 0.1
482 0.1
483 0.08
484 0.08
485 0.06
486 0.04
487 0.04
488 0.03
489 0.04
490 0.04
491 0.07
492 0.07
493 0.08
494 0.09
495 0.14
496 0.2
497 0.21
498 0.21
499 0.2
500 0.27
501 0.3
502 0.33
503 0.29
504 0.23
505 0.21
506 0.21
507 0.19
508 0.13
509 0.09
510 0.07
511 0.08
512 0.08
513 0.08
514 0.08
515 0.1
516 0.1
517 0.1
518 0.09
519 0.07
520 0.08
521 0.1
522 0.11
523 0.12
524 0.13
525 0.17
526 0.24
527 0.28
528 0.36
529 0.44
530 0.51
531 0.55
532 0.62
533 0.6
534 0.62
535 0.68
536 0.64
537 0.64
538 0.65
539 0.68
540 0.67
541 0.76
542 0.78
543 0.79
544 0.86
545 0.87
546 0.89
547 0.9
548 0.92
549 0.93
550 0.94
551 0.94
552 0.93
553 0.9
554 0.86
555 0.79
556 0.76
557 0.72
558 0.7
559 0.67
560 0.63
561 0.58
562 0.52
563 0.56
564 0.55
565 0.53
566 0.46
567 0.45
568 0.44
569 0.51
570 0.6
571 0.6
572 0.61
573 0.6
574 0.67
575 0.66
576 0.71
577 0.71
578 0.7
579 0.73
580 0.75
581 0.81
582 0.8
583 0.83
584 0.84
585 0.85
586 0.87
587 0.86
588 0.82
589 0.75
590 0.71
591 0.65
592 0.55
593 0.45
594 0.35
595 0.26
596 0.19
597 0.16
598 0.1
599 0.06
600 0.05
601 0.04
602 0.04
603 0.03
604 0.03
605 0.04
606 0.06
607 0.07
608 0.07
609 0.08
610 0.08
611 0.09
612 0.1
613 0.11
614 0.11
615 0.13
616 0.15
617 0.21
618 0.22
619 0.21
620 0.22
621 0.21
622 0.26
623 0.26
624 0.26
625 0.23
626 0.23
627 0.26
628 0.27
629 0.29
630 0.29
631 0.35
632 0.34
633 0.38
634 0.46
635 0.46
636 0.46
637 0.45
638 0.4
639 0.41
640 0.5
641 0.54
642 0.55
643 0.62
644 0.68
645 0.77
646 0.84
647 0.87