Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162MSF4

Protein Details
Accession A0A162MSF4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-98HCNFCDKSFKRPQDLKKHERIHNEENHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MDYSRYNCRWENCNKIYTDPEHLYSHLTNDHVGRKSTGNLCLTCHWEDCEVSVVKRDHITSHLRVHVPLKPHHCNFCDKSFKRPQDLKKHERIHNEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.53
4 0.49
5 0.48
6 0.4
7 0.39
8 0.35
9 0.34
10 0.33
11 0.28
12 0.27
13 0.21
14 0.19
15 0.17
16 0.18
17 0.23
18 0.22
19 0.22
20 0.22
21 0.21
22 0.25
23 0.26
24 0.29
25 0.26
26 0.24
27 0.25
28 0.25
29 0.28
30 0.25
31 0.23
32 0.18
33 0.16
34 0.16
35 0.14
36 0.16
37 0.12
38 0.11
39 0.16
40 0.16
41 0.16
42 0.17
43 0.17
44 0.14
45 0.18
46 0.23
47 0.21
48 0.26
49 0.3
50 0.29
51 0.3
52 0.31
53 0.31
54 0.3
55 0.33
56 0.36
57 0.39
58 0.43
59 0.48
60 0.47
61 0.53
62 0.52
63 0.55
64 0.58
65 0.52
66 0.58
67 0.62
68 0.66
69 0.67
70 0.71
71 0.72
72 0.73
73 0.82
74 0.81
75 0.81
76 0.84
77 0.81
78 0.83