Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168K3A6

Protein Details
Accession A0A168K3A6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
102-126AGDSNDRRSKKKKVTKTPAEQEPATHydrophilic
NLS Segment(s)
PositionSequence
108-114RRSKKKK
Subcellular Location(s) mito_nucl 13.166, mito 13, nucl 12, cyto_mito 8.166, cyto_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR017423  TRM6  
Gene Ontology GO:0005634  C:nucleus  
GO:0031515  C:tRNA (m1A) methyltransferase complex  
GO:0030488  P:tRNA methylation  
Amino Acid Sequences MSGTGLLRLYTFATLCTARLIGKPFGLSYEIINKQGEIRSVGHVSKNNNIELTESSMREYQVLPGRMHPNMNMSCGGGGGYLLSTLCVIDCPSDPSLVKKSAGDSNDRRSKKKKVTKTPAEQEPATAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.14
5 0.13
6 0.17
7 0.2
8 0.19
9 0.2
10 0.2
11 0.19
12 0.19
13 0.2
14 0.17
15 0.14
16 0.21
17 0.22
18 0.23
19 0.23
20 0.21
21 0.22
22 0.23
23 0.22
24 0.17
25 0.16
26 0.17
27 0.2
28 0.21
29 0.23
30 0.24
31 0.26
32 0.29
33 0.3
34 0.27
35 0.25
36 0.24
37 0.22
38 0.19
39 0.22
40 0.18
41 0.16
42 0.17
43 0.17
44 0.17
45 0.16
46 0.15
47 0.14
48 0.18
49 0.2
50 0.19
51 0.22
52 0.25
53 0.25
54 0.25
55 0.21
56 0.21
57 0.19
58 0.2
59 0.17
60 0.14
61 0.13
62 0.13
63 0.12
64 0.06
65 0.05
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.06
78 0.1
79 0.1
80 0.13
81 0.13
82 0.17
83 0.21
84 0.23
85 0.23
86 0.21
87 0.23
88 0.27
89 0.28
90 0.33
91 0.34
92 0.42
93 0.51
94 0.54
95 0.57
96 0.59
97 0.67
98 0.7
99 0.74
100 0.75
101 0.77
102 0.84
103 0.89
104 0.93
105 0.92
106 0.9
107 0.86
108 0.75