Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162R3F2

Protein Details
Accession A0A162R3F2   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
127-153DKKSLFEKEKLSKKKKQTSPESVLKEIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
IPR019814  Translation_initiation_fac_3_N  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF05198  IF3_N  
Amino Acid Sequences MLSTRQLLKPTLRFISQTSQYSSLAQALPIRSTVNGIQRQRQSLRPLNPLQPMQQQQQQPQQVQKSPSGRSRRDEEISSRFITFVNEQGQVKERCRVKDVLMEFDRSRYFLIEVDPTVKPPVCRLFDKKSLFEKEKLSKKKKQTSPESVLKEIVFGWNVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.44
4 0.42
5 0.4
6 0.39
7 0.38
8 0.37
9 0.35
10 0.29
11 0.23
12 0.21
13 0.19
14 0.18
15 0.17
16 0.17
17 0.17
18 0.13
19 0.16
20 0.18
21 0.23
22 0.3
23 0.32
24 0.38
25 0.42
26 0.48
27 0.48
28 0.5
29 0.5
30 0.51
31 0.54
32 0.54
33 0.55
34 0.54
35 0.56
36 0.52
37 0.47
38 0.46
39 0.44
40 0.39
41 0.41
42 0.39
43 0.39
44 0.45
45 0.47
46 0.43
47 0.44
48 0.45
49 0.43
50 0.42
51 0.43
52 0.4
53 0.39
54 0.44
55 0.47
56 0.46
57 0.45
58 0.48
59 0.47
60 0.45
61 0.43
62 0.4
63 0.37
64 0.36
65 0.34
66 0.29
67 0.24
68 0.21
69 0.2
70 0.16
71 0.14
72 0.14
73 0.15
74 0.15
75 0.16
76 0.21
77 0.22
78 0.23
79 0.26
80 0.27
81 0.27
82 0.3
83 0.31
84 0.27
85 0.31
86 0.31
87 0.34
88 0.32
89 0.34
90 0.3
91 0.31
92 0.3
93 0.24
94 0.23
95 0.15
96 0.14
97 0.11
98 0.13
99 0.13
100 0.13
101 0.16
102 0.16
103 0.16
104 0.19
105 0.19
106 0.17
107 0.2
108 0.27
109 0.27
110 0.33
111 0.39
112 0.43
113 0.51
114 0.56
115 0.57
116 0.58
117 0.62
118 0.61
119 0.59
120 0.6
121 0.6
122 0.65
123 0.7
124 0.7
125 0.7
126 0.76
127 0.83
128 0.83
129 0.84
130 0.84
131 0.83
132 0.84
133 0.85
134 0.81
135 0.72
136 0.67
137 0.57
138 0.47
139 0.37
140 0.32