Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168NSB2

Protein Details
Accession A0A168NSB2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-63KVRGDKFRAEKNKKKRGSYRGGQBasic
NLS Segment(s)
PositionSequence
45-57DKFRAEKNKKKRG
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences QRVKPEEVEFLDERLKDNTYDAKGGSDMASYGWKASQDLIKVRGDKFRAEKNKKKRGSYRGGQISFESHSIKFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.18
4 0.19
5 0.23
6 0.21
7 0.22
8 0.2
9 0.19
10 0.18
11 0.18
12 0.16
13 0.1
14 0.08
15 0.07
16 0.08
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.1
24 0.11
25 0.13
26 0.16
27 0.18
28 0.2
29 0.21
30 0.26
31 0.25
32 0.27
33 0.3
34 0.36
35 0.44
36 0.52
37 0.6
38 0.66
39 0.75
40 0.78
41 0.83
42 0.83
43 0.81
44 0.82
45 0.8
46 0.8
47 0.8
48 0.74
49 0.67
50 0.59
51 0.52
52 0.44
53 0.39
54 0.31