Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168KPB5

Protein Details
Accession A0A168KPB5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-121LAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKEBasic
NLS Segment(s)
PositionSequence
79-121PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
Subcellular Location(s) mito 19, cyto 5.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences TRKFLTNRLLQRKQMVVDVIHPGLANVSKDELRTKIGKMYKSDKEVVSVFGFKTHFGGGKTTGFALIYDNVEALKKFEPKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.36
4 0.32
5 0.33
6 0.27
7 0.23
8 0.21
9 0.17
10 0.16
11 0.16
12 0.14
13 0.1
14 0.12
15 0.12
16 0.13
17 0.16
18 0.16
19 0.18
20 0.2
21 0.2
22 0.25
23 0.29
24 0.32
25 0.34
26 0.4
27 0.42
28 0.45
29 0.47
30 0.4
31 0.39
32 0.35
33 0.32
34 0.27
35 0.22
36 0.17
37 0.17
38 0.17
39 0.14
40 0.14
41 0.12
42 0.12
43 0.11
44 0.13
45 0.12
46 0.12
47 0.12
48 0.11
49 0.1
50 0.09
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.1
62 0.13
63 0.15
64 0.22
65 0.29
66 0.34
67 0.44
68 0.48
69 0.51
70 0.48
71 0.52
72 0.48
73 0.44
74 0.41
75 0.33
76 0.27
77 0.22
78 0.23
79 0.2
80 0.21
81 0.26
82 0.32
83 0.39
84 0.5
85 0.6
86 0.7
87 0.77
88 0.86
89 0.89
90 0.92
91 0.94
92 0.94
93 0.94
94 0.93
95 0.93
96 0.92
97 0.92
98 0.92
99 0.92
100 0.93
101 0.94