Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162Z064

Protein Details
Accession A0A162Z064    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-27ILWAAPKKKTSHSKKRMRASNKGLQQHydrophilic
NLS Segment(s)
PositionSequence
7-20PKKKTSHSKKRMRA
Subcellular Location(s) nucl 17, mito_nucl 13.499, cyto_nucl 10.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences PILWAAPKKKTSHSKKRMRASNKGLQQKENVTTCPACGSNKLLHHLCGNCYSDIKKKAKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.89
4 0.89
5 0.86
6 0.85
7 0.82
8 0.8
9 0.78
10 0.78
11 0.7
12 0.62
13 0.57
14 0.51
15 0.47
16 0.4
17 0.32
18 0.25
19 0.23
20 0.21
21 0.2
22 0.18
23 0.13
24 0.14
25 0.16
26 0.19
27 0.21
28 0.27
29 0.26
30 0.26
31 0.31
32 0.31
33 0.3
34 0.3
35 0.3
36 0.26
37 0.27
38 0.3
39 0.33
40 0.41
41 0.45