Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168PMG1

Protein Details
Accession A0A168PMG1   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-31SFVPLPGLNQKKRPRRKFHEVERLYQHydrophilic
60-80RQPSEFKELRKMWRKQKRDNKBasic
NLS Segment(s)
PositionSequence
16-21KKRPRR
58-80PKRQPSEFKELRKMWRKQKRDNK
Subcellular Location(s) mito 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences SQKVFSFVPLPGLNQKKRPRRKFHEVERLYQCNFQDCTKSYGTLNHLNAHVSMQRHGPKRQPSEFKELRKMWRKQKRDNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.57
3 0.61
4 0.71
5 0.78
6 0.8
7 0.81
8 0.87
9 0.88
10 0.89
11 0.9
12 0.82
13 0.8
14 0.77
15 0.71
16 0.62
17 0.55
18 0.44
19 0.38
20 0.36
21 0.28
22 0.25
23 0.22
24 0.25
25 0.22
26 0.23
27 0.18
28 0.2
29 0.24
30 0.27
31 0.26
32 0.24
33 0.24
34 0.23
35 0.23
36 0.21
37 0.2
38 0.14
39 0.14
40 0.18
41 0.24
42 0.29
43 0.33
44 0.39
45 0.45
46 0.53
47 0.6
48 0.64
49 0.62
50 0.68
51 0.72
52 0.72
53 0.72
54 0.7
55 0.71
56 0.72
57 0.76
58 0.76
59 0.79
60 0.81