Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168MZG8

Protein Details
Accession A0A168MZG8   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
78-104SSLARHRRIHTGKRPYKCRHDGCNKSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 13.666, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences KPYKCNMLNCAKAFGRRSDLARHLRIHTNERPYVCQELGCGKSFIQRSALKVHMRTHSGERPHVCEFEDCKKNFSDSSSLARHRRIHTGKRPYKCRHDGCNKSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.39
4 0.41
5 0.42
6 0.48
7 0.5
8 0.52
9 0.51
10 0.49
11 0.52
12 0.53
13 0.53
14 0.51
15 0.51
16 0.5
17 0.48
18 0.47
19 0.43
20 0.43
21 0.35
22 0.29
23 0.23
24 0.24
25 0.25
26 0.23
27 0.21
28 0.17
29 0.21
30 0.22
31 0.22
32 0.22
33 0.21
34 0.21
35 0.25
36 0.3
37 0.27
38 0.29
39 0.32
40 0.29
41 0.29
42 0.3
43 0.31
44 0.31
45 0.31
46 0.34
47 0.32
48 0.33
49 0.33
50 0.32
51 0.28
52 0.26
53 0.27
54 0.31
55 0.38
56 0.34
57 0.34
58 0.34
59 0.35
60 0.32
61 0.31
62 0.27
63 0.22
64 0.28
65 0.32
66 0.38
67 0.4
68 0.46
69 0.49
70 0.47
71 0.55
72 0.57
73 0.61
74 0.65
75 0.72
76 0.75
77 0.78
78 0.85
79 0.84
80 0.86
81 0.86
82 0.83
83 0.83
84 0.85