Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162Q323

Protein Details
Accession A0A162Q323   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31SLSPIVKKQCPKTCKSKNRRTLLRPCTQLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019012  RNA_cap_Gua-N2-MeTrfase  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0009452  P:7-methylguanosine RNA capping  
GO:0001510  P:RNA methylation  
Pfam View protein in Pfam  
PF09445  Methyltransf_15  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSLSPIVKKQCPKTCKSKNRRTLLRPCTQLENRYYYQRYAYFSKFDQGILMDKEGWFSVTPEKIARHIALRCQSDIIIDAFCGCGGNSIQFALTCERVIAIDLDPVKLHCARENAKIYGVADRIEFILGDFFDLAPNLKADCVFLSPPWGGPAYMAEDVYDLKSMIPGDGMNIHKIASSITPNVAFFVPRNTDPQQLAQLAGPGNTCEIELNSLNGKIKALTAYYGELINYDQLEKIEADIAEEELIAKIAQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.85
4 0.86
5 0.86
6 0.89
7 0.93
8 0.91
9 0.91
10 0.89
11 0.87
12 0.82
13 0.76
14 0.75
15 0.7
16 0.67
17 0.61
18 0.59
19 0.53
20 0.55
21 0.54
22 0.46
23 0.46
24 0.43
25 0.42
26 0.41
27 0.41
28 0.37
29 0.35
30 0.38
31 0.33
32 0.3
33 0.26
34 0.21
35 0.23
36 0.21
37 0.21
38 0.17
39 0.16
40 0.17
41 0.16
42 0.16
43 0.11
44 0.11
45 0.15
46 0.15
47 0.16
48 0.18
49 0.2
50 0.21
51 0.23
52 0.23
53 0.23
54 0.24
55 0.29
56 0.34
57 0.35
58 0.33
59 0.31
60 0.3
61 0.25
62 0.24
63 0.18
64 0.11
65 0.09
66 0.08
67 0.07
68 0.07
69 0.07
70 0.05
71 0.05
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.09
79 0.09
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.09
86 0.08
87 0.06
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.11
94 0.12
95 0.12
96 0.12
97 0.17
98 0.19
99 0.26
100 0.31
101 0.29
102 0.28
103 0.29
104 0.26
105 0.24
106 0.22
107 0.15
108 0.11
109 0.1
110 0.1
111 0.09
112 0.08
113 0.05
114 0.05
115 0.04
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.04
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.07
130 0.07
131 0.07
132 0.1
133 0.1
134 0.1
135 0.11
136 0.11
137 0.09
138 0.09
139 0.1
140 0.1
141 0.11
142 0.1
143 0.09
144 0.09
145 0.1
146 0.1
147 0.1
148 0.06
149 0.05
150 0.07
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06
156 0.11
157 0.12
158 0.12
159 0.12
160 0.12
161 0.12
162 0.12
163 0.12
164 0.09
165 0.11
166 0.11
167 0.13
168 0.14
169 0.13
170 0.15
171 0.14
172 0.13
173 0.11
174 0.15
175 0.17
176 0.17
177 0.23
178 0.24
179 0.28
180 0.29
181 0.31
182 0.31
183 0.28
184 0.28
185 0.22
186 0.23
187 0.19
188 0.18
189 0.15
190 0.11
191 0.11
192 0.1
193 0.1
194 0.08
195 0.08
196 0.11
197 0.11
198 0.13
199 0.14
200 0.17
201 0.18
202 0.18
203 0.18
204 0.15
205 0.16
206 0.15
207 0.14
208 0.13
209 0.13
210 0.15
211 0.15
212 0.15
213 0.14
214 0.13
215 0.12
216 0.13
217 0.12
218 0.11
219 0.11
220 0.1
221 0.12
222 0.12
223 0.12
224 0.14
225 0.13
226 0.14
227 0.14
228 0.14
229 0.12
230 0.12
231 0.12
232 0.08
233 0.09