Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168MVW7

Protein Details
Accession A0A168MVW7   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-77DVILWRKKYKKYKPLTTVKRCTCCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, mito_nucl 13.166, cyto_nucl 12.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019351  DUF2039  
Pfam View protein in Pfam  
PF10217  DUF2039  
Amino Acid Sequences MSTYENKGSNRKGNNAKKGQAHQNTTSWKANKNSKKSREIAALPVYGLCQRCTDVILWRKKYKKYKPLTTVKRCTCCQEKAIKEAYHVLCDNCARSKRVCAKCLESKEILVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.74
4 0.73
5 0.75
6 0.76
7 0.73
8 0.69
9 0.63
10 0.61
11 0.6
12 0.58
13 0.58
14 0.5
15 0.48
16 0.49
17 0.55
18 0.58
19 0.63
20 0.68
21 0.68
22 0.73
23 0.7
24 0.67
25 0.64
26 0.57
27 0.52
28 0.45
29 0.38
30 0.3
31 0.27
32 0.23
33 0.19
34 0.18
35 0.13
36 0.1
37 0.1
38 0.1
39 0.11
40 0.12
41 0.16
42 0.23
43 0.3
44 0.35
45 0.41
46 0.46
47 0.53
48 0.62
49 0.65
50 0.66
51 0.68
52 0.73
53 0.77
54 0.83
55 0.86
56 0.85
57 0.86
58 0.83
59 0.8
60 0.71
61 0.68
62 0.63
63 0.56
64 0.52
65 0.52
66 0.47
67 0.47
68 0.53
69 0.48
70 0.43
71 0.48
72 0.43
73 0.38
74 0.36
75 0.31
76 0.27
77 0.28
78 0.29
79 0.27
80 0.3
81 0.28
82 0.29
83 0.39
84 0.46
85 0.53
86 0.55
87 0.55
88 0.6
89 0.66
90 0.71
91 0.67
92 0.59