Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168NP15

Protein Details
Accession A0A168NP15   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
119-139FYWSTNKKPVPQKWQNSKVLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR005631  SDH  
IPR036714  SDH_sf  
IPR028882  SDHAF2  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006121  P:mitochondrial electron transport, succinate to ubiquinone  
GO:0018293  P:protein-FAD linkage  
Pfam View protein in Pfam  
PF03937  Sdh5  
Amino Acid Sequences MSLSRARQVQQLARPVYRSISTLRPLFNKKSEDPFPDLAIRHSSEAALDSSYPNLPPIPRPNEETENKRRRLTYQSRKRGILETDLLLSTFAKVWLPQFNREQLEEYDKLLDEPDWDIFYWSTNKKPVPQKWQNSKVLEMITQHAKNEDKKVLRMPNLEEASSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.44
4 0.37
5 0.32
6 0.27
7 0.29
8 0.32
9 0.33
10 0.36
11 0.39
12 0.44
13 0.48
14 0.51
15 0.5
16 0.49
17 0.53
18 0.55
19 0.53
20 0.53
21 0.49
22 0.45
23 0.43
24 0.39
25 0.33
26 0.31
27 0.27
28 0.23
29 0.21
30 0.18
31 0.14
32 0.15
33 0.13
34 0.1
35 0.09
36 0.08
37 0.09
38 0.1
39 0.1
40 0.09
41 0.1
42 0.1
43 0.14
44 0.22
45 0.26
46 0.28
47 0.32
48 0.36
49 0.42
50 0.46
51 0.49
52 0.52
53 0.55
54 0.57
55 0.55
56 0.51
57 0.47
58 0.53
59 0.55
60 0.56
61 0.58
62 0.65
63 0.66
64 0.67
65 0.66
66 0.59
67 0.49
68 0.42
69 0.32
70 0.23
71 0.19
72 0.17
73 0.16
74 0.12
75 0.11
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.07
82 0.14
83 0.16
84 0.2
85 0.23
86 0.28
87 0.29
88 0.3
89 0.31
90 0.26
91 0.29
92 0.26
93 0.24
94 0.21
95 0.19
96 0.18
97 0.16
98 0.14
99 0.09
100 0.1
101 0.1
102 0.09
103 0.1
104 0.11
105 0.1
106 0.12
107 0.17
108 0.18
109 0.2
110 0.25
111 0.27
112 0.34
113 0.43
114 0.5
115 0.55
116 0.63
117 0.7
118 0.76
119 0.83
120 0.83
121 0.77
122 0.71
123 0.64
124 0.55
125 0.47
126 0.38
127 0.33
128 0.33
129 0.31
130 0.29
131 0.3
132 0.33
133 0.35
134 0.4
135 0.44
136 0.4
137 0.43
138 0.51
139 0.55
140 0.57
141 0.58
142 0.56
143 0.57
144 0.56