Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168NHU5

Protein Details
Accession A0A168NHU5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25SGGKKAKKKWSAKKVKDKANNLVILHydrophilic
NLS Segment(s)
PositionSequence
3-17GKKAKKKWSAKKVKD
Subcellular Location(s) mito 14, nucl 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences SGGKKAKKKWSAKKVKDKANNLVILDKPTYDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELEAQGLIKAISRHHAQVIYTRATGDEKKPAASEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.91
4 0.87
5 0.85
6 0.81
7 0.74
8 0.64
9 0.59
10 0.49
11 0.42
12 0.36
13 0.27
14 0.21
15 0.21
16 0.22
17 0.19
18 0.19
19 0.2
20 0.22
21 0.22
22 0.29
23 0.3
24 0.31
25 0.33
26 0.35
27 0.31
28 0.33
29 0.33
30 0.25
31 0.2
32 0.2
33 0.17
34 0.19
35 0.18
36 0.14
37 0.14
38 0.14
39 0.14
40 0.12
41 0.12
42 0.1
43 0.11
44 0.11
45 0.11
46 0.11
47 0.1
48 0.1
49 0.1
50 0.09
51 0.09
52 0.08
53 0.09
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.08
60 0.08
61 0.08
62 0.13
63 0.15
64 0.16
65 0.19
66 0.21
67 0.19
68 0.25
69 0.29
70 0.29
71 0.27
72 0.25
73 0.24
74 0.26
75 0.3
76 0.27
77 0.31
78 0.29
79 0.31