Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168J645

Protein Details
Accession A0A168J645    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-92KKRSEYDQKHRTRQERQKKKQEMDSKRRHAQDEBasic
NLS Segment(s)
PositionSequence
68-87KHRTRQERQKKKQEMDSKRR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences DAEVDYYELLGLEITASAKEIKNAYRRKALKVHPDKNPSPDAAVLFHALTQAQDLLLDPKKRSEYDQKHRTRQERQKKKQEMDSKRRHAQDELEKREQEAKRAKTDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.08
5 0.09
6 0.11
7 0.14
8 0.19
9 0.28
10 0.35
11 0.39
12 0.47
13 0.49
14 0.53
15 0.59
16 0.6
17 0.62
18 0.67
19 0.69
20 0.68
21 0.73
22 0.7
23 0.66
24 0.61
25 0.51
26 0.41
27 0.35
28 0.27
29 0.2
30 0.19
31 0.14
32 0.12
33 0.11
34 0.09
35 0.08
36 0.07
37 0.06
38 0.05
39 0.04
40 0.04
41 0.04
42 0.07
43 0.11
44 0.14
45 0.14
46 0.17
47 0.19
48 0.2
49 0.25
50 0.32
51 0.38
52 0.47
53 0.58
54 0.62
55 0.69
56 0.77
57 0.79
58 0.79
59 0.8
60 0.8
61 0.81
62 0.84
63 0.86
64 0.88
65 0.87
66 0.86
67 0.86
68 0.85
69 0.85
70 0.85
71 0.83
72 0.82
73 0.8
74 0.73
75 0.66
76 0.64
77 0.64
78 0.64
79 0.63
80 0.63
81 0.59
82 0.58
83 0.63
84 0.56
85 0.54
86 0.53
87 0.51