Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4W2K1

Protein Details
Accession J4W2K1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-39QQTLHPKTPKTPKTPRTPRTPASHydrophilic
NLS Segment(s)
PositionSequence
137-184AREEEQRREELRRRREEEETKRRLAPGSRSIRAPASSRGSVSRARARA
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013960  DASH_Duo1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF08651  DASH_Duo1  
Amino Acid Sequences MADDSEYTESDIWASPQQTLHPKTPKTPKTPRTPRTPASEGPDRDTLLRKELEGVKNVNQAIEGLIGTLQRAGGNMNVVTQTVNNASSLLNSWTRILSQTEHNQRLILDPRWKGTTEDLAEQEAEALQRQQEAERRAREEEQRREELRRRREEEETKRRLAPGSRSIRAPASSRGSVSRARARAGSRIGTASSYSSYNTSSSSSRGTSGLGRGVGRGAGTARGTRSRGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.23
5 0.31
6 0.35
7 0.42
8 0.46
9 0.48
10 0.55
11 0.65
12 0.68
13 0.69
14 0.75
15 0.75
16 0.77
17 0.86
18 0.84
19 0.84
20 0.84
21 0.79
22 0.77
23 0.74
24 0.67
25 0.64
26 0.66
27 0.57
28 0.53
29 0.51
30 0.43
31 0.4
32 0.41
33 0.35
34 0.3
35 0.29
36 0.24
37 0.27
38 0.33
39 0.34
40 0.32
41 0.34
42 0.33
43 0.37
44 0.37
45 0.31
46 0.24
47 0.21
48 0.17
49 0.14
50 0.1
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.07
68 0.08
69 0.07
70 0.08
71 0.07
72 0.08
73 0.07
74 0.07
75 0.09
76 0.1
77 0.1
78 0.1
79 0.11
80 0.1
81 0.11
82 0.12
83 0.12
84 0.11
85 0.15
86 0.23
87 0.31
88 0.33
89 0.33
90 0.32
91 0.3
92 0.32
93 0.31
94 0.28
95 0.25
96 0.24
97 0.26
98 0.27
99 0.27
100 0.25
101 0.22
102 0.23
103 0.19
104 0.2
105 0.19
106 0.18
107 0.17
108 0.16
109 0.14
110 0.09
111 0.07
112 0.05
113 0.05
114 0.04
115 0.05
116 0.06
117 0.08
118 0.12
119 0.17
120 0.23
121 0.26
122 0.29
123 0.31
124 0.35
125 0.41
126 0.46
127 0.5
128 0.51
129 0.54
130 0.53
131 0.57
132 0.61
133 0.62
134 0.62
135 0.63
136 0.61
137 0.59
138 0.66
139 0.69
140 0.73
141 0.74
142 0.71
143 0.65
144 0.61
145 0.58
146 0.53
147 0.47
148 0.43
149 0.42
150 0.44
151 0.43
152 0.43
153 0.44
154 0.43
155 0.41
156 0.36
157 0.33
158 0.31
159 0.3
160 0.3
161 0.3
162 0.31
163 0.32
164 0.35
165 0.37
166 0.33
167 0.34
168 0.36
169 0.36
170 0.4
171 0.4
172 0.37
173 0.31
174 0.3
175 0.29
176 0.26
177 0.24
178 0.19
179 0.17
180 0.15
181 0.14
182 0.14
183 0.14
184 0.14
185 0.14
186 0.15
187 0.15
188 0.17
189 0.19
190 0.19
191 0.19
192 0.19
193 0.2
194 0.2
195 0.22
196 0.23
197 0.23
198 0.22
199 0.21
200 0.21
201 0.2
202 0.17
203 0.15
204 0.12
205 0.13
206 0.15
207 0.18
208 0.21
209 0.26
210 0.28