Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168N407

Protein Details
Accession A0A168N407    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-101ATKNGRRVIIRRRMKGRKFLSHBasic
NLS Segment(s)
PositionSequence
69-98RKRRHGFLARLATKNGRRVIIRRRMKGRKF
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLFQQLLSTASARFNAVAARPSMLGQSSSILSASLGAFRTPSTITSSFGATQMRFVTYGNTYQPSQLVRKRRHGFLARLATKNGRRVIIRRRMKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.15
5 0.15
6 0.15
7 0.15
8 0.15
9 0.15
10 0.14
11 0.13
12 0.1
13 0.11
14 0.1
15 0.1
16 0.09
17 0.08
18 0.07
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.09
27 0.08
28 0.09
29 0.13
30 0.13
31 0.15
32 0.15
33 0.17
34 0.16
35 0.17
36 0.17
37 0.11
38 0.12
39 0.11
40 0.11
41 0.1
42 0.09
43 0.1
44 0.1
45 0.12
46 0.12
47 0.14
48 0.14
49 0.14
50 0.16
51 0.16
52 0.21
53 0.25
54 0.33
55 0.37
56 0.47
57 0.52
58 0.54
59 0.6
60 0.61
61 0.61
62 0.61
63 0.65
64 0.61
65 0.58
66 0.57
67 0.56
68 0.53
69 0.55
70 0.5
71 0.43
72 0.41
73 0.46
74 0.54
75 0.57
76 0.62
77 0.64
78 0.71
79 0.78
80 0.81
81 0.85