Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168IT65

Protein Details
Accession A0A168IT65   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
71-113EKVKYDEKKHIKKREENIKAKIDEKKNKKRGIKMKPAAKKARPBasic
118-138GKRSKGGKVTKPSPPNNKGKKBasic
NLS Segment(s)
PositionSequence
42-138KDDAKLLKKTIKRQEKLKTKSGQEWNKRIEKVKYDEKKHIKKREENIKAKIDEKKNKKRGIKMKPAAKKARPGFEGGKRSKGGKVTKPSPPNNKGKK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029190  Rrp14/SURF6_C  
IPR007019  SURF6  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04935  SURF6  
Amino Acid Sequences MLEAKKEKLEKLKEENKSKAEELIEKDEWNKVIALATGEKPKDDAKLLKKTIKRQEKLKTKSGQEWNKRIEKVKYDEKKHIKKREENIKAKIDEKKNKKRGIKMKPAAKKARPGFEGGKRSKGGKVTKPSPPNNKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.71
4 0.68
5 0.61
6 0.55
7 0.49
8 0.45
9 0.41
10 0.41
11 0.38
12 0.34
13 0.34
14 0.33
15 0.3
16 0.25
17 0.2
18 0.13
19 0.12
20 0.12
21 0.13
22 0.12
23 0.15
24 0.19
25 0.19
26 0.19
27 0.19
28 0.2
29 0.2
30 0.21
31 0.25
32 0.27
33 0.37
34 0.41
35 0.46
36 0.5
37 0.57
38 0.64
39 0.67
40 0.64
41 0.63
42 0.69
43 0.73
44 0.74
45 0.73
46 0.69
47 0.62
48 0.66
49 0.67
50 0.67
51 0.64
52 0.65
53 0.63
54 0.62
55 0.6
56 0.56
57 0.49
58 0.45
59 0.43
60 0.47
61 0.49
62 0.48
63 0.56
64 0.62
65 0.69
66 0.73
67 0.76
68 0.74
69 0.74
70 0.79
71 0.8
72 0.81
73 0.78
74 0.76
75 0.73
76 0.67
77 0.63
78 0.62
79 0.61
80 0.6
81 0.63
82 0.67
83 0.69
84 0.76
85 0.78
86 0.8
87 0.81
88 0.82
89 0.83
90 0.81
91 0.82
92 0.82
93 0.85
94 0.85
95 0.79
96 0.79
97 0.74
98 0.73
99 0.65
100 0.62
101 0.6
102 0.59
103 0.64
104 0.58
105 0.59
106 0.52
107 0.53
108 0.51
109 0.52
110 0.51
111 0.5
112 0.56
113 0.56
114 0.64
115 0.71
116 0.77
117 0.8
118 0.8