A0A168LDN4

UniProt ID: A0A168LDN4   Organism: Mucor lusitanicus CBS 277.49
Gene: MUCCIDRAFT_141840   Protein: Uncharacterized protein (Fragment)
Length: 142 AA

Protein Details

• Accession: A0A168LDN4
• Localization Confidence: High
• Confidence Score: 16
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  90-110	TPFEKSKKTVREQKKLAHFPL	Hydrophilic

• NLS Segment(s):

  Position	Sequence
  79-107	VKKTRAMRRALTPFEKSKKTVREQKKLAH

• Subcellular Location(s): nucl 20, mito 5
• Family & Domain DBs:
  • InterPro:
    • IPR001854 Ribosomal_L29/L35
    • IPR036049 Ribosomal_L29/L35_sf
    • IPR045059 RL35
  • Gene Ontology:
    • GO:0022625 C:cytosolic large ribosomal subunit
    • GO:0003735 F:structural constituent of ribosome
    • GO:0000463 P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
    • GO:0006412 P:translation
  • Pfam:
    • PF00831 Ribosomal_L29
  • CDD:
    • cd00427 Ribosomal_L29_HIP
• Amino Acid Sequences: VKAFELRNKNKAELLKILDEQKQQLANIRVQKVAGGRSQEVGEARKNVARVLTVINQTQREQLRLFYQKKRFTPLDLRVKKTRAMRRALTPFEKSKKTVREQKKLAHFPLRKYAVKA

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.45
2, 0.42
3, 0.41
4, 0.43
5, 0.43
6, 0.41
7, 0.38
8, 0.35
9, 0.32
10, 0.28
11, 0.32
12, 0.31
13, 0.31
14, 0.36
15, 0.36
16, 0.33
17, 0.31
18, 0.33
19, 0.28
20, 0.27
21, 0.24
22, 0.2
23, 0.19
24, 0.2
25, 0.2
26, 0.2
27, 0.19
28, 0.18
29, 0.18
30, 0.16
31, 0.17
32, 0.17
33, 0.17
34, 0.16
35, 0.15
36, 0.13
37, 0.12
38, 0.13
39, 0.15
40, 0.16
41, 0.17
42, 0.19
43, 0.2
44, 0.2
45, 0.24
46, 0.21
47, 0.2
48, 0.18
49, 0.18
50, 0.22
51, 0.29
52, 0.33
53, 0.37
54, 0.45
55, 0.5
56, 0.51
57, 0.57
58, 0.52
59, 0.49
60, 0.53
61, 0.54
62, 0.57
63, 0.56
64, 0.6
65, 0.59
66, 0.6
67, 0.6
68, 0.6
69, 0.59
70, 0.55
71, 0.56
72, 0.54
73, 0.58
74, 0.64
75, 0.65
76, 0.62
77, 0.59
78, 0.6
79, 0.6
80, 0.6
81, 0.54
82, 0.54
83, 0.56
84, 0.6
85, 0.65
86, 0.67
87, 0.7
88, 0.74
89, 0.8
90, 0.82
91, 0.82
92, 0.8
93, 0.8
94, 0.74
95, 0.7
96, 0.73
97, 0.71