Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162YTV2

Protein Details
Accession A0A162YTV2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-34HCKHTDRKLISIKKKGRPATQCKRCRELRBasic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences GHRATHCKHTDRKLISIKKKGRPATQCKRCRELRVLRQLHVKCDCEDPSKHGERAIDIQLYSYSQIKVQVRQKRAAIAMPILAYLQVHDSIAFFFFFFSIHATDRLMWNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.78
4 0.78
5 0.77
6 0.81
7 0.79
8 0.78
9 0.78
10 0.79
11 0.8
12 0.81
13 0.82
14 0.8
15 0.8
16 0.77
17 0.73
18 0.72
19 0.71
20 0.71
21 0.73
22 0.69
23 0.65
24 0.68
25 0.63
26 0.59
27 0.54
28 0.46
29 0.36
30 0.37
31 0.36
32 0.31
33 0.31
34 0.29
35 0.31
36 0.33
37 0.31
38 0.29
39 0.27
40 0.24
41 0.26
42 0.24
43 0.17
44 0.13
45 0.13
46 0.12
47 0.12
48 0.12
49 0.1
50 0.08
51 0.08
52 0.14
53 0.15
54 0.22
55 0.3
56 0.37
57 0.39
58 0.44
59 0.44
60 0.42
61 0.42
62 0.38
63 0.32
64 0.25
65 0.23
66 0.18
67 0.17
68 0.13
69 0.11
70 0.09
71 0.07
72 0.08
73 0.06
74 0.06
75 0.06
76 0.07
77 0.08
78 0.09
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.09
86 0.1
87 0.12
88 0.13
89 0.15
90 0.16