Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168MX10

Protein Details
Accession A0A168MX10    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-45GKVKSQCPKVAKQEKKKPKTGRAKKRQVYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
19-36KVAKQEKKKPKTGRAKKR
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQCPKVAKQEKKKPKTGRAKKRQVYNRRFVNVTTQVGGKRRMNPAPTAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.5
4 0.52
5 0.59
6 0.63
7 0.68
8 0.71
9 0.73
10 0.78
11 0.82
12 0.84
13 0.86
14 0.84
15 0.83
16 0.85
17 0.85
18 0.85
19 0.85
20 0.88
21 0.84
22 0.85
23 0.85
24 0.85
25 0.83
26 0.81
27 0.78
28 0.71
29 0.67
30 0.58
31 0.56
32 0.51
33 0.45
34 0.37
35 0.31
36 0.31
37 0.34
38 0.4
39 0.36
40 0.36
41 0.41
42 0.47
43 0.47
44 0.48