Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4VWK2

Protein Details
Accession J4VWK2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30LEVLRVKNPKRNPKNPCTIVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPQKPIRLPPLEVLRVKNPKRNPKNPCTIVMSSVLACWASAGYNAAGCAAIETQLRQCMDGPKPPPAPPNTINHHMGRLGKYITYDGKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.6
4 0.61
5 0.61
6 0.65
7 0.73
8 0.78
9 0.78
10 0.77
11 0.83
12 0.78
13 0.73
14 0.69
15 0.6
16 0.52
17 0.45
18 0.37
19 0.26
20 0.22
21 0.18
22 0.11
23 0.09
24 0.07
25 0.05
26 0.04
27 0.04
28 0.05
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.07
41 0.1
42 0.11
43 0.11
44 0.12
45 0.17
46 0.2
47 0.26
48 0.28
49 0.32
50 0.35
51 0.37
52 0.42
53 0.4
54 0.44
55 0.41
56 0.46
57 0.45
58 0.48
59 0.5
60 0.45
61 0.44
62 0.4
63 0.4
64 0.35
65 0.32
66 0.28
67 0.25
68 0.25
69 0.27
70 0.29