Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168GZ80

Protein Details
Accession A0A168GZ80    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-30IVDSVEKKPRKRFVGRAKKAASNAHydrophilic
NLS Segment(s)
PositionSequence
13-25KKPRKRFVGRAKK
Subcellular Location(s) cyto 12.5, cyto_nucl 8.5, mito 5, nucl 3.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016435  DPH1/DPH2  
IPR042263  DPH1/DPH2_1  
IPR042264  DPH1/DPH2_2  
IPR042265  DPH1/DPH2_3  
Gene Ontology GO:0090560  F:2-(3-amino-3-carboxypropyl)histidine synthase activity  
GO:0051536  F:iron-sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0017183  P:peptidyl-diphthamide biosynthetic process from peptidyl-histidine  
Pfam View protein in Pfam  
PF01866  Diphthamide_syn  
Amino Acid Sequences MEKQEAIVDSVEKKPRKRFVGRAKKAASNANNEAGGAIEDGAVGFAKAPRARSSRVANQVPDEILNDPLLNKSLETMPSNYNFEIHKTVWRVRKAKAKRVALQLPEGLMMFACLIADILEIFCDAETLIMGDVTYGACCVDDYTARALGCDFLVHYGHSCLVPVDITTIETLYVFVDIGIDTQHFIATVKKNFEKGSRLVLVGTIQFAAALQASKAPLEEDFTVFIPQSKPLSPGEILGCTSPKLTDMDYIVCIGDGRFHLESIMIHNPDLPAFQYNPYGKTFTRERYDHVEMHSLRKHAISVAKEAKKYGLVLGTLGRQGKPQILEYLEQAIKEQGKESVNVLLSEIFPGKLEQFEDVDAWIQIACPRLSIDWGYAFPKPLLTPYEASIALGKAEWQDVYPMDFYANDSLGPWTPNHGRGVPRKRRTVVASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.67
4 0.73
5 0.76
6 0.78
7 0.84
8 0.86
9 0.87
10 0.84
11 0.8
12 0.76
13 0.75
14 0.69
15 0.66
16 0.62
17 0.56
18 0.5
19 0.43
20 0.38
21 0.29
22 0.24
23 0.15
24 0.1
25 0.06
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.13
34 0.15
35 0.18
36 0.25
37 0.3
38 0.34
39 0.4
40 0.47
41 0.51
42 0.58
43 0.62
44 0.57
45 0.55
46 0.54
47 0.48
48 0.41
49 0.33
50 0.24
51 0.2
52 0.18
53 0.15
54 0.12
55 0.12
56 0.13
57 0.12
58 0.1
59 0.11
60 0.13
61 0.17
62 0.19
63 0.21
64 0.24
65 0.27
66 0.3
67 0.28
68 0.27
69 0.25
70 0.25
71 0.27
72 0.24
73 0.27
74 0.29
75 0.36
76 0.41
77 0.5
78 0.51
79 0.52
80 0.62
81 0.64
82 0.69
83 0.71
84 0.72
85 0.71
86 0.76
87 0.77
88 0.69
89 0.65
90 0.56
91 0.47
92 0.38
93 0.31
94 0.21
95 0.14
96 0.11
97 0.07
98 0.05
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.05
128 0.06
129 0.08
130 0.1
131 0.13
132 0.13
133 0.13
134 0.12
135 0.12
136 0.11
137 0.1
138 0.08
139 0.06
140 0.07
141 0.07
142 0.08
143 0.08
144 0.09
145 0.08
146 0.08
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.05
173 0.1
174 0.14
175 0.18
176 0.22
177 0.23
178 0.26
179 0.27
180 0.3
181 0.3
182 0.26
183 0.29
184 0.26
185 0.24
186 0.22
187 0.21
188 0.19
189 0.14
190 0.13
191 0.07
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.04
198 0.03
199 0.04
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.07
206 0.08
207 0.08
208 0.08
209 0.09
210 0.1
211 0.09
212 0.11
213 0.09
214 0.1
215 0.11
216 0.11
217 0.13
218 0.12
219 0.16
220 0.14
221 0.16
222 0.15
223 0.14
224 0.14
225 0.12
226 0.12
227 0.1
228 0.1
229 0.08
230 0.07
231 0.08
232 0.08
233 0.09
234 0.1
235 0.11
236 0.11
237 0.12
238 0.11
239 0.09
240 0.09
241 0.07
242 0.08
243 0.06
244 0.1
245 0.09
246 0.09
247 0.1
248 0.1
249 0.11
250 0.13
251 0.17
252 0.14
253 0.14
254 0.15
255 0.15
256 0.14
257 0.14
258 0.11
259 0.09
260 0.09
261 0.11
262 0.16
263 0.17
264 0.19
265 0.21
266 0.23
267 0.21
268 0.25
269 0.29
270 0.29
271 0.34
272 0.33
273 0.35
274 0.4
275 0.45
276 0.42
277 0.4
278 0.42
279 0.36
280 0.41
281 0.41
282 0.34
283 0.3
284 0.28
285 0.26
286 0.21
287 0.26
288 0.21
289 0.26
290 0.35
291 0.38
292 0.38
293 0.39
294 0.37
295 0.33
296 0.31
297 0.25
298 0.18
299 0.14
300 0.14
301 0.15
302 0.16
303 0.17
304 0.18
305 0.16
306 0.15
307 0.16
308 0.19
309 0.19
310 0.19
311 0.2
312 0.21
313 0.21
314 0.21
315 0.27
316 0.24
317 0.22
318 0.21
319 0.21
320 0.21
321 0.2
322 0.2
323 0.17
324 0.18
325 0.19
326 0.2
327 0.21
328 0.21
329 0.2
330 0.2
331 0.16
332 0.15
333 0.16
334 0.16
335 0.1
336 0.1
337 0.11
338 0.11
339 0.11
340 0.12
341 0.12
342 0.12
343 0.13
344 0.13
345 0.13
346 0.13
347 0.11
348 0.11
349 0.09
350 0.08
351 0.09
352 0.12
353 0.12
354 0.11
355 0.12
356 0.13
357 0.16
358 0.16
359 0.17
360 0.16
361 0.18
362 0.21
363 0.21
364 0.23
365 0.2
366 0.21
367 0.19
368 0.2
369 0.21
370 0.23
371 0.23
372 0.23
373 0.27
374 0.24
375 0.25
376 0.23
377 0.19
378 0.16
379 0.14
380 0.13
381 0.1
382 0.12
383 0.11
384 0.1
385 0.12
386 0.13
387 0.16
388 0.15
389 0.14
390 0.13
391 0.13
392 0.15
393 0.16
394 0.16
395 0.13
396 0.13
397 0.15
398 0.17
399 0.18
400 0.16
401 0.19
402 0.24
403 0.28
404 0.32
405 0.34
406 0.4
407 0.49
408 0.6
409 0.65
410 0.69
411 0.74
412 0.73
413 0.77