Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168MI55

Protein Details
Accession A0A168MI55    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
291-316LDMIAPLSNRQRRLKKKRRQQKKRYHBasic
NLS Segment(s)
PositionSequence
300-316RQRRLKKKRRQQKKRYH
Subcellular Location(s) plas 19, E.R. 5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008521  Mg_trans_NIPA  
Gene Ontology GO:0016020  C:membrane  
GO:0015095  F:magnesium ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF05653  Mg_trans_NIPA  
Amino Acid Sequences MTLEGRYVGLILAICSSLLIGISFVVTKKGLQNSSTAEHGRASDSHRYLKNPVWWIGLIVMVMGEILNFIGYTFAPAILITPLGALSVIVGAILGSVFLKEKMGPIGIIGCLLSVIGAVIIIFHAPEDPDVQSVQELVAYMLKPGFLVYGILVILIVVGMIWKVVPRYGKTKPIVYLSICSLIGSLSVMAVKAFGIAVKLTVAGNNQFNQPSTYIFGFMCALFILVQVNYFNKALDLFCTNVVNPIYYVCFTTATIIASAIMFQGWNTASLTNTVSLICGFLIIFSGVYLLDMIAPLSNRQRRLKKKRRQQKKRYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.05
5 0.05
6 0.05
7 0.04
8 0.04
9 0.05
10 0.06
11 0.07
12 0.09
13 0.09
14 0.11
15 0.17
16 0.24
17 0.26
18 0.26
19 0.3
20 0.32
21 0.35
22 0.38
23 0.34
24 0.28
25 0.27
26 0.27
27 0.25
28 0.23
29 0.25
30 0.29
31 0.31
32 0.37
33 0.39
34 0.42
35 0.44
36 0.48
37 0.5
38 0.47
39 0.46
40 0.42
41 0.39
42 0.36
43 0.32
44 0.26
45 0.18
46 0.12
47 0.09
48 0.05
49 0.05
50 0.04
51 0.03
52 0.02
53 0.02
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.04
85 0.04
86 0.05
87 0.05
88 0.06
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.08
95 0.08
96 0.07
97 0.05
98 0.05
99 0.04
100 0.04
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.03
113 0.04
114 0.05
115 0.06
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.06
122 0.05
123 0.05
124 0.04
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.04
134 0.04
135 0.03
136 0.04
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.02
143 0.02
144 0.01
145 0.01
146 0.01
147 0.02
148 0.02
149 0.02
150 0.03
151 0.05
152 0.07
153 0.09
154 0.15
155 0.19
156 0.27
157 0.29
158 0.32
159 0.32
160 0.33
161 0.34
162 0.29
163 0.28
164 0.21
165 0.21
166 0.18
167 0.16
168 0.12
169 0.09
170 0.08
171 0.07
172 0.05
173 0.03
174 0.03
175 0.04
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.05
188 0.06
189 0.07
190 0.09
191 0.11
192 0.12
193 0.14
194 0.14
195 0.15
196 0.16
197 0.15
198 0.14
199 0.15
200 0.14
201 0.14
202 0.13
203 0.13
204 0.13
205 0.12
206 0.11
207 0.08
208 0.08
209 0.06
210 0.06
211 0.06
212 0.05
213 0.06
214 0.07
215 0.07
216 0.09
217 0.1
218 0.09
219 0.09
220 0.1
221 0.1
222 0.11
223 0.12
224 0.11
225 0.13
226 0.14
227 0.14
228 0.17
229 0.17
230 0.16
231 0.13
232 0.13
233 0.14
234 0.13
235 0.14
236 0.11
237 0.12
238 0.11
239 0.13
240 0.13
241 0.12
242 0.12
243 0.11
244 0.1
245 0.09
246 0.09
247 0.07
248 0.06
249 0.05
250 0.04
251 0.07
252 0.07
253 0.08
254 0.09
255 0.1
256 0.1
257 0.12
258 0.14
259 0.11
260 0.12
261 0.11
262 0.1
263 0.1
264 0.1
265 0.08
266 0.07
267 0.06
268 0.05
269 0.06
270 0.06
271 0.06
272 0.05
273 0.06
274 0.05
275 0.06
276 0.06
277 0.05
278 0.04
279 0.05
280 0.05
281 0.06
282 0.07
283 0.11
284 0.2
285 0.26
286 0.33
287 0.43
288 0.53
289 0.63
290 0.74
291 0.82
292 0.83
293 0.89
294 0.93
295 0.94
296 0.95