Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168QCF6

Protein Details
Accession A0A168QCF6    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKSAKFYKRPSKKEKEGLAIKKLHydrophilic
75-96TSNAAQEKKKEKKEKEPELPDYHydrophilic
NLS Segment(s)
PositionSequence
8-44YKRPSKKEKEGLAIKKLIEPTTITKKGSKEAKKIHVP
51-53KKK
83-87KKEKK
103-114KKTYKKIPKKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MGKSAKFYKRPSKKEKEGLAIKKLIEPTTITKKGSKEAKKIHVPASMFADKKKKETAPAPAPAVDQDVEMDVDETSNAAQEKKKEKKEKEPELPDYVDLFSGKKTYKKIPKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.84
5 0.81
6 0.77
7 0.7
8 0.6
9 0.54
10 0.49
11 0.4
12 0.31
13 0.27
14 0.26
15 0.33
16 0.35
17 0.33
18 0.34
19 0.35
20 0.41
21 0.48
22 0.48
23 0.48
24 0.53
25 0.59
26 0.63
27 0.65
28 0.62
29 0.57
30 0.51
31 0.43
32 0.42
33 0.38
34 0.31
35 0.3
36 0.34
37 0.3
38 0.32
39 0.35
40 0.29
41 0.29
42 0.33
43 0.39
44 0.37
45 0.4
46 0.38
47 0.34
48 0.33
49 0.29
50 0.27
51 0.18
52 0.12
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.05
59 0.05
60 0.04
61 0.04
62 0.04
63 0.05
64 0.06
65 0.07
66 0.09
67 0.16
68 0.26
69 0.35
70 0.46
71 0.54
72 0.61
73 0.7
74 0.79
75 0.84
76 0.84
77 0.84
78 0.8
79 0.76
80 0.7
81 0.6
82 0.51
83 0.41
84 0.32
85 0.24
86 0.18
87 0.14
88 0.17
89 0.18
90 0.21
91 0.26
92 0.35
93 0.45
94 0.56