Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168P566

Protein Details
Accession A0A168P566    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21RDPRGRKKKKADDTLPKHPMSBasic
NLS Segment(s)
PositionSequence
4-10RGRKKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences RDPRGRKKKKADDTLPKHPMSAYLHFAKEMRPIMKKRFPTARLVEISKEIGNEWRAMAQIDLQKWMDMANLDKARYAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.76
4 0.65
5 0.54
6 0.49
7 0.43
8 0.38
9 0.32
10 0.29
11 0.29
12 0.29
13 0.29
14 0.25
15 0.25
16 0.25
17 0.23
18 0.26
19 0.3
20 0.37
21 0.43
22 0.45
23 0.45
24 0.49
25 0.48
26 0.49
27 0.49
28 0.46
29 0.43
30 0.41
31 0.37
32 0.3
33 0.3
34 0.23
35 0.19
36 0.14
37 0.14
38 0.14
39 0.13
40 0.12
41 0.11
42 0.11
43 0.11
44 0.11
45 0.12
46 0.15
47 0.16
48 0.19
49 0.18
50 0.18
51 0.18
52 0.18
53 0.15
54 0.12
55 0.14
56 0.2
57 0.23
58 0.23
59 0.26