Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168N6D6

Protein Details
Accession A0A168N6D6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-82SFLIKRRSHSKSKSKNKKKTKSKGKSKKSSDCSKRSCHydrophilic
NLS Segment(s)
PositionSequence
50-73KRRSHSKSKSKNKKKTKSKGKSKK
Subcellular Location(s) extr 8, E.R. 7, golg 5, cyto 2, vacu 2, nucl 1, mito 1, plas 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MKFTISSITIFLFVITALLVDSLSAFSHPLDMIVSSVDRHSKNVASFLIKRRSHSKSKSKNKKKTKSKGKSKKSSDCSKRSCPLKLKPCPKDCPQSCGYLDSPDPCCPLLGKPTCPDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.04
6 0.03
7 0.03
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.05
14 0.07
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.06
23 0.08
24 0.12
25 0.12
26 0.14
27 0.16
28 0.17
29 0.18
30 0.2
31 0.21
32 0.2
33 0.25
34 0.31
35 0.38
36 0.37
37 0.39
38 0.43
39 0.47
40 0.51
41 0.55
42 0.59
43 0.6
44 0.7
45 0.79
46 0.83
47 0.88
48 0.91
49 0.92
50 0.92
51 0.92
52 0.92
53 0.92
54 0.92
55 0.93
56 0.93
57 0.92
58 0.91
59 0.9
60 0.86
61 0.86
62 0.84
63 0.83
64 0.8
65 0.77
66 0.76
67 0.71
68 0.7
69 0.68
70 0.68
71 0.69
72 0.72
73 0.75
74 0.77
75 0.8
76 0.79
77 0.78
78 0.79
79 0.71
80 0.68
81 0.59
82 0.56
83 0.5
84 0.47
85 0.42
86 0.35
87 0.34
88 0.32
89 0.34
90 0.3
91 0.31
92 0.26
93 0.26
94 0.23
95 0.24
96 0.29
97 0.31
98 0.34