Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162RRF1

Protein Details
Accession A0A162RRF1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
187-213MEEKKAKAKAERKAKKAENKKNGVVSDHydrophilic
NLS Segment(s)
PositionSequence
189-207EKKAKAKAERKAKKAENKK
Subcellular Location(s) cyto 15.5, cyto_nucl 12, nucl 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIPRRIELVKEKAKNIVLNPDLERAAAWLYCALSKLLLEQPVVSDGLGKLYNQDAIIEYLLDPSIYGDGDKICSHITSLKDTTKLNLTPNPAYNEKVSNLDSATMGSLDRDLKSKFVCPISMKEMNGKHRFVYLDTCGCVFAEQAMKEIPSKECCGKPFESQNVIVINPTKEEQESMRKVMEEKKAKAKAERKAKKAENKKNGVVSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.48
4 0.49
5 0.53
6 0.57
7 0.54
8 0.48
9 0.47
10 0.4
11 0.39
12 0.39
13 0.37
14 0.33
15 0.29
16 0.26
17 0.18
18 0.17
19 0.13
20 0.11
21 0.09
22 0.1
23 0.1
24 0.11
25 0.1
26 0.09
27 0.09
28 0.12
29 0.14
30 0.15
31 0.15
32 0.14
33 0.15
34 0.16
35 0.16
36 0.12
37 0.1
38 0.08
39 0.11
40 0.11
41 0.1
42 0.1
43 0.1
44 0.12
45 0.1
46 0.11
47 0.09
48 0.1
49 0.1
50 0.09
51 0.08
52 0.08
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.09
68 0.12
69 0.13
70 0.16
71 0.19
72 0.2
73 0.23
74 0.23
75 0.24
76 0.24
77 0.24
78 0.23
79 0.23
80 0.25
81 0.25
82 0.28
83 0.3
84 0.27
85 0.27
86 0.25
87 0.24
88 0.21
89 0.21
90 0.18
91 0.15
92 0.14
93 0.13
94 0.11
95 0.1
96 0.09
97 0.06
98 0.05
99 0.04
100 0.06
101 0.06
102 0.07
103 0.09
104 0.09
105 0.11
106 0.12
107 0.14
108 0.16
109 0.17
110 0.19
111 0.19
112 0.22
113 0.28
114 0.3
115 0.29
116 0.31
117 0.35
118 0.41
119 0.44
120 0.41
121 0.34
122 0.33
123 0.34
124 0.29
125 0.28
126 0.23
127 0.21
128 0.21
129 0.21
130 0.18
131 0.17
132 0.16
133 0.12
134 0.1
135 0.12
136 0.11
137 0.12
138 0.12
139 0.13
140 0.14
141 0.17
142 0.18
143 0.17
144 0.21
145 0.25
146 0.28
147 0.29
148 0.33
149 0.34
150 0.38
151 0.42
152 0.45
153 0.44
154 0.42
155 0.43
156 0.39
157 0.36
158 0.31
159 0.26
160 0.21
161 0.18
162 0.18
163 0.16
164 0.15
165 0.17
166 0.19
167 0.26
168 0.29
169 0.3
170 0.31
171 0.31
172 0.33
173 0.39
174 0.45
175 0.44
176 0.45
177 0.53
178 0.58
179 0.61
180 0.68
181 0.69
182 0.68
183 0.71
184 0.75
185 0.71
186 0.75
187 0.8
188 0.81
189 0.85
190 0.86
191 0.86
192 0.85
193 0.85