Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168PPH4

Protein Details
Accession A0A168PPH4    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-30KECYKCRKPFTLLRRKHHCRTCGBasic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043548  PIKfyve  
IPR000306  Znf_FYVE  
IPR017455  Znf_FYVE-rel  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000285  F:1-phosphatidylinositol-3-phosphate 5-kinase activity  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01363  FYVE  
PROSITE View protein in PROSITE  
PS50178  ZF_FYVE  
Amino Acid Sequences WMPDEQCKECYKCRKPFTLLRRKHHCRTCGQIFCGRCASHVISGKLFKQKGQVRVCNFCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.7
3 0.75
4 0.78
5 0.78
6 0.77
7 0.77
8 0.81
9 0.81
10 0.84
11 0.81
12 0.75
13 0.69
14 0.68
15 0.68
16 0.62
17 0.57
18 0.53
19 0.46
20 0.44
21 0.43
22 0.34
23 0.25
24 0.24
25 0.23
26 0.24
27 0.29
28 0.28
29 0.27
30 0.3
31 0.34
32 0.38
33 0.37
34 0.32
35 0.36
36 0.41
37 0.48
38 0.54
39 0.59
40 0.58