Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168KFG8

Protein Details
Accession A0A168KFG8   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
119-139TSSQRKSRRMSVRERRRTRAEHydrophilic
NLS Segment(s)
PositionSequence
131-134RERR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014767  DAD_dom  
IPR015425  FH2_Formin  
IPR042201  FH2_Formin_sf  
PROSITE View protein in PROSITE  
PS51231  DAD  
PS51444  FH2  
Amino Acid Sequences MYKFRDRAIEKFDQLEVRYTSMDVAYKDVVSYFGEDPSDMKPDEFFGIFQTFTSSWNKAKSDLEMQKKKKEQAEKTKEFQAQRKARLNNRLDIKDENQEDKDIMDNLLEKLRSGEMANTSSQRKSRRMSVRERRRTRAESMVVKAEDLLRHIQNEEEAPPLPRAARSGSRRFTSSERMKKLASLADNKGEEVAVNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.35
4 0.29
5 0.27
6 0.24
7 0.22
8 0.19
9 0.2
10 0.15
11 0.17
12 0.16
13 0.15
14 0.15
15 0.14
16 0.14
17 0.12
18 0.15
19 0.12
20 0.12
21 0.13
22 0.13
23 0.14
24 0.15
25 0.17
26 0.14
27 0.13
28 0.12
29 0.14
30 0.16
31 0.15
32 0.13
33 0.13
34 0.14
35 0.14
36 0.13
37 0.15
38 0.13
39 0.15
40 0.19
41 0.19
42 0.2
43 0.25
44 0.26
45 0.25
46 0.26
47 0.27
48 0.33
49 0.38
50 0.46
51 0.51
52 0.55
53 0.61
54 0.64
55 0.66
56 0.63
57 0.65
58 0.64
59 0.66
60 0.72
61 0.69
62 0.68
63 0.7
64 0.68
65 0.63
66 0.59
67 0.58
68 0.54
69 0.55
70 0.6
71 0.59
72 0.6
73 0.65
74 0.62
75 0.58
76 0.57
77 0.51
78 0.46
79 0.42
80 0.38
81 0.35
82 0.34
83 0.3
84 0.24
85 0.23
86 0.2
87 0.18
88 0.17
89 0.11
90 0.09
91 0.07
92 0.07
93 0.08
94 0.1
95 0.09
96 0.08
97 0.09
98 0.09
99 0.09
100 0.09
101 0.1
102 0.1
103 0.12
104 0.13
105 0.15
106 0.17
107 0.18
108 0.23
109 0.26
110 0.29
111 0.3
112 0.39
113 0.46
114 0.51
115 0.6
116 0.67
117 0.73
118 0.79
119 0.83
120 0.81
121 0.79
122 0.76
123 0.7
124 0.67
125 0.63
126 0.58
127 0.54
128 0.53
129 0.45
130 0.41
131 0.36
132 0.3
133 0.23
134 0.19
135 0.2
136 0.15
137 0.16
138 0.17
139 0.17
140 0.16
141 0.17
142 0.16
143 0.14
144 0.14
145 0.15
146 0.16
147 0.16
148 0.16
149 0.15
150 0.15
151 0.19
152 0.27
153 0.33
154 0.41
155 0.47
156 0.49
157 0.5
158 0.52
159 0.52
160 0.53
161 0.56
162 0.57
163 0.57
164 0.57
165 0.56
166 0.55
167 0.54
168 0.5
169 0.46
170 0.43
171 0.42
172 0.46
173 0.46
174 0.44
175 0.4
176 0.33