Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168HEK4

Protein Details
Accession A0A168HEK4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-66QQRHMQQLFDKKRRRRESHNAVERRRRDBasic
NLS Segment(s)
PositionSequence
49-64KKRRRRESHNAVERRR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
CDD cd11387  bHLHzip_USF_MITF  
Amino Acid Sequences MYYSNNKNNSTNAGSDSFSANARPNMTSPSIEHIDEELQQRHMQQLFDKKRRRRESHNAVERRRRDNINERIYELSTLLPERDASKNNKGTILRKSVDHIRLLHDKVNQYQQRVQELENMLDMYRMRWGELPSNSANNTTTTTNSNLNLSNIPSSYYQQQHRDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.27
4 0.22
5 0.19
6 0.19
7 0.19
8 0.19
9 0.21
10 0.21
11 0.2
12 0.23
13 0.25
14 0.24
15 0.22
16 0.25
17 0.26
18 0.25
19 0.24
20 0.21
21 0.2
22 0.22
23 0.25
24 0.2
25 0.19
26 0.2
27 0.2
28 0.23
29 0.23
30 0.21
31 0.22
32 0.31
33 0.4
34 0.49
35 0.58
36 0.6
37 0.69
38 0.79
39 0.8
40 0.79
41 0.8
42 0.81
43 0.83
44 0.86
45 0.84
46 0.81
47 0.84
48 0.79
49 0.74
50 0.68
51 0.59
52 0.56
53 0.57
54 0.59
55 0.58
56 0.54
57 0.5
58 0.47
59 0.44
60 0.38
61 0.28
62 0.18
63 0.11
64 0.1
65 0.08
66 0.07
67 0.07
68 0.09
69 0.11
70 0.14
71 0.18
72 0.25
73 0.29
74 0.3
75 0.34
76 0.33
77 0.35
78 0.37
79 0.39
80 0.32
81 0.29
82 0.32
83 0.35
84 0.35
85 0.35
86 0.3
87 0.28
88 0.33
89 0.34
90 0.34
91 0.31
92 0.3
93 0.3
94 0.39
95 0.37
96 0.35
97 0.38
98 0.37
99 0.39
100 0.38
101 0.36
102 0.32
103 0.32
104 0.28
105 0.25
106 0.22
107 0.17
108 0.17
109 0.16
110 0.1
111 0.12
112 0.12
113 0.12
114 0.14
115 0.17
116 0.23
117 0.24
118 0.29
119 0.27
120 0.31
121 0.3
122 0.29
123 0.28
124 0.22
125 0.23
126 0.2
127 0.19
128 0.19
129 0.21
130 0.23
131 0.23
132 0.24
133 0.23
134 0.24
135 0.24
136 0.23
137 0.23
138 0.2
139 0.21
140 0.2
141 0.22
142 0.27
143 0.32
144 0.37