Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168IZQ4

Protein Details
Accession A0A168IZQ4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20NHRDLKAKRKRASPNQLVVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.833, mito 13.5, nucl 13, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences NHRDLKAKRKRASPNQLVVLNRIFNQTYFPSTEIRIELGKQLGMSPRTVQIWFQNKRQALRSRGKHHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.76
4 0.67
5 0.6
6 0.51
7 0.42
8 0.33
9 0.27
10 0.21
11 0.16
12 0.18
13 0.17
14 0.16
15 0.16
16 0.16
17 0.15
18 0.16
19 0.17
20 0.14
21 0.14
22 0.12
23 0.11
24 0.11
25 0.11
26 0.1
27 0.09
28 0.1
29 0.13
30 0.14
31 0.15
32 0.14
33 0.16
34 0.18
35 0.18
36 0.18
37 0.23
38 0.32
39 0.35
40 0.39
41 0.45
42 0.47
43 0.51
44 0.58
45 0.58
46 0.57
47 0.63
48 0.68