Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168M075

Protein Details
Accession A0A168M075    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-61RILMRLVNKRRKECQKLKKAAKNQSRFHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 13.5, mito 8.5
Family & Domain DBs
Amino Acid Sequences MQGKAVKVLLENRPVYCLCLLNIFRPFAQIYLLRILMRLVNKRRKECQKLKKAAKNQSRFHLVIKQQQEICKSIYKAQLLRILRVRGVSRKRKEMDQQSGGSTDEARGDDTIAKGKKTALAFVLADSSAWVKDKVAENKELDLYLSSNEDDEFSISSPSLDELFENKTNEADVSLRNTGSYLNLQESALE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.32
4 0.27
5 0.19
6 0.25
7 0.26
8 0.28
9 0.31
10 0.31
11 0.28
12 0.29
13 0.29
14 0.21
15 0.23
16 0.19
17 0.18
18 0.2
19 0.22
20 0.19
21 0.19
22 0.19
23 0.19
24 0.23
25 0.29
26 0.34
27 0.43
28 0.5
29 0.57
30 0.66
31 0.73
32 0.78
33 0.8
34 0.81
35 0.83
36 0.86
37 0.9
38 0.9
39 0.89
40 0.88
41 0.88
42 0.86
43 0.8
44 0.76
45 0.72
46 0.63
47 0.57
48 0.55
49 0.48
50 0.47
51 0.46
52 0.44
53 0.4
54 0.42
55 0.41
56 0.35
57 0.33
58 0.29
59 0.27
60 0.27
61 0.29
62 0.3
63 0.29
64 0.3
65 0.35
66 0.32
67 0.34
68 0.34
69 0.3
70 0.27
71 0.28
72 0.26
73 0.27
74 0.36
75 0.42
76 0.42
77 0.49
78 0.5
79 0.52
80 0.58
81 0.59
82 0.58
83 0.53
84 0.5
85 0.43
86 0.42
87 0.38
88 0.3
89 0.21
90 0.13
91 0.1
92 0.09
93 0.08
94 0.07
95 0.08
96 0.08
97 0.09
98 0.15
99 0.14
100 0.14
101 0.14
102 0.15
103 0.18
104 0.18
105 0.19
106 0.13
107 0.15
108 0.15
109 0.15
110 0.15
111 0.11
112 0.1
113 0.09
114 0.09
115 0.06
116 0.07
117 0.07
118 0.06
119 0.11
120 0.19
121 0.26
122 0.29
123 0.33
124 0.33
125 0.35
126 0.36
127 0.32
128 0.25
129 0.18
130 0.15
131 0.12
132 0.12
133 0.1
134 0.09
135 0.09
136 0.09
137 0.09
138 0.09
139 0.09
140 0.08
141 0.09
142 0.09
143 0.09
144 0.08
145 0.09
146 0.09
147 0.08
148 0.08
149 0.1
150 0.15
151 0.2
152 0.21
153 0.2
154 0.2
155 0.21
156 0.2
157 0.19
158 0.15
159 0.14
160 0.18
161 0.2
162 0.19
163 0.19
164 0.19
165 0.18
166 0.19
167 0.21
168 0.18
169 0.19
170 0.2