Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168GW71

Protein Details
Accession A0A168GW71   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTEEVQKKRSRRTVKHERAVVGHydrophilic
NLS Segment(s)
PositionSequence
8-18KRSRRTVKHER
27-76AIRAKRNQKPDARAAARQAAISKSKDAKKAAAAAKKAANPAGSQAKVSKQ
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MTEEVQKKRSRRTVKHERAVVGASWDAIRAKRNQKPDARAAARQAAISKSKDAKKAAAAAKKAANPAGSQAKVSKQQAKGFAPKAAATSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.84
4 0.75
5 0.67
6 0.6
7 0.49
8 0.4
9 0.3
10 0.21
11 0.15
12 0.14
13 0.12
14 0.11
15 0.14
16 0.18
17 0.27
18 0.32
19 0.4
20 0.47
21 0.52
22 0.56
23 0.6
24 0.63
25 0.58
26 0.55
27 0.5
28 0.46
29 0.4
30 0.35
31 0.29
32 0.21
33 0.21
34 0.2
35 0.2
36 0.22
37 0.25
38 0.29
39 0.3
40 0.3
41 0.29
42 0.35
43 0.38
44 0.38
45 0.36
46 0.35
47 0.37
48 0.38
49 0.37
50 0.31
51 0.26
52 0.2
53 0.24
54 0.28
55 0.24
56 0.24
57 0.25
58 0.28
59 0.34
60 0.4
61 0.42
62 0.41
63 0.46
64 0.53
65 0.56
66 0.6
67 0.56
68 0.54
69 0.49
70 0.44