Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162YTG8

Protein Details
Accession A0A162YTG8   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MWDDVKKHNKAKPQPRQPYTPIHydrophilic
108-127AMRTRERQRLIKLRNNETKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MWDDVKKHNKAKPQPRQPYTPISMNEDDVDMLDEDDDEADEEADEEDEDSDSPIKAKRRRANAKQLEVLNRVFDRTFFPSTQMRAELGRQLGMSPRTVQIWFQNRRQAMRTRERQRLIKLRNNETKATTKSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.84
4 0.79
5 0.77
6 0.71
7 0.67
8 0.58
9 0.54
10 0.5
11 0.44
12 0.39
13 0.31
14 0.25
15 0.18
16 0.17
17 0.1
18 0.08
19 0.07
20 0.06
21 0.06
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.1
41 0.17
42 0.22
43 0.32
44 0.37
45 0.48
46 0.58
47 0.65
48 0.73
49 0.74
50 0.74
51 0.69
52 0.66
53 0.59
54 0.52
55 0.44
56 0.35
57 0.26
58 0.22
59 0.17
60 0.15
61 0.14
62 0.16
63 0.19
64 0.17
65 0.2
66 0.22
67 0.23
68 0.25
69 0.22
70 0.19
71 0.17
72 0.18
73 0.19
74 0.16
75 0.16
76 0.14
77 0.13
78 0.17
79 0.17
80 0.17
81 0.15
82 0.15
83 0.16
84 0.17
85 0.18
86 0.22
87 0.31
88 0.35
89 0.39
90 0.45
91 0.46
92 0.49
93 0.53
94 0.53
95 0.52
96 0.58
97 0.63
98 0.64
99 0.71
100 0.75
101 0.77
102 0.78
103 0.8
104 0.78
105 0.76
106 0.77
107 0.78
108 0.8
109 0.78
110 0.72
111 0.67
112 0.66