Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168HY40

Protein Details
Accession A0A168HY40    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26SSGGKKAKKKWSAKKVKDKANNLVILHydrophilic
NLS Segment(s)
PositionSequence
4-18GKKAKKKWSAKKVKD
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences SSGGKKAKKKWSAKKVKDKANNLVILDKPTYDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELEAQGLIKAISRHHAQVIYSKLRTPCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.91
3 0.92
4 0.91
5 0.87
6 0.84
7 0.81
8 0.74
9 0.63
10 0.58
11 0.48
12 0.41
13 0.35
14 0.26
15 0.2
16 0.2
17 0.21
18 0.18
19 0.18
20 0.19
21 0.21
22 0.21
23 0.28
24 0.29
25 0.3
26 0.32
27 0.33
28 0.3
29 0.32
30 0.32
31 0.24
32 0.19
33 0.19
34 0.16
35 0.18
36 0.17
37 0.13
38 0.13
39 0.14
40 0.14
41 0.13
42 0.12
43 0.1
44 0.12
45 0.12
46 0.12
47 0.12
48 0.11
49 0.11
50 0.11
51 0.1
52 0.1
53 0.09
54 0.1
55 0.09
56 0.09
57 0.09
58 0.09
59 0.07
60 0.09
61 0.09
62 0.09
63 0.14
64 0.16
65 0.18
66 0.21
67 0.23
68 0.22
69 0.28
70 0.35
71 0.38
72 0.37
73 0.4