Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162YIK1

Protein Details
Accession A0A162YIK1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSKSKNHTNHNQIKKAHRNGHydrophilic
NLS Segment(s)
PositionSequence
15-26KAHRNGLKKPIA
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQIKKAHRNGLKKPIAHKYGTQKGLDAKFLRNQRFAKKGTQKALAAAAGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.77
4 0.74
5 0.73
6 0.73
7 0.77
8 0.73
9 0.66
10 0.64
11 0.64
12 0.59
13 0.53
14 0.5
15 0.48
16 0.5
17 0.5
18 0.44
19 0.37
20 0.38
21 0.38
22 0.38
23 0.31
24 0.26
25 0.29
26 0.36
27 0.39
28 0.4
29 0.43
30 0.46
31 0.51
32 0.51
33 0.55
34 0.58
35 0.62
36 0.62
37 0.65
38 0.58
39 0.54
40 0.55
41 0.47