Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168Q8S8

Protein Details
Accession A0A168Q8S8    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MARTRSSQNGQTKKTKKTRKRSGLPQITRCPHIHydrophilic
138-161AEKITLKRAAPRGKKRNGPDTHKVBasic
NLS Segment(s)
PositionSequence
13-21KKTKKTRKR
143-155LKRAAPRGKKRNG
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001523  Paired_dom  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00292  PAX  
Amino Acid Sequences MARTRSSQNGQTKKTKKTRKRSGLPQITRCPHIRQLIMEKSYDQLKTPTEIARELNISRETISGIIKRYEETGSIEYKSVGGDNRSKIKEHHRQFLLNAIEENNTITLEELQSKLIKEFGDIQSIGLSTLCKFLKHNAEKITLKRAAPRGKKRNGPDTHKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.82
4 0.84
5 0.89
6 0.89
7 0.92
8 0.92
9 0.93
10 0.93
11 0.92
12 0.9
13 0.88
14 0.81
15 0.76
16 0.69
17 0.63
18 0.58
19 0.55
20 0.48
21 0.42
22 0.47
23 0.5
24 0.48
25 0.43
26 0.37
27 0.33
28 0.35
29 0.3
30 0.23
31 0.18
32 0.17
33 0.19
34 0.21
35 0.21
36 0.19
37 0.2
38 0.2
39 0.2
40 0.21
41 0.18
42 0.2
43 0.18
44 0.17
45 0.16
46 0.15
47 0.14
48 0.12
49 0.14
50 0.12
51 0.13
52 0.14
53 0.13
54 0.13
55 0.15
56 0.14
57 0.13
58 0.14
59 0.14
60 0.14
61 0.15
62 0.14
63 0.13
64 0.12
65 0.12
66 0.09
67 0.08
68 0.09
69 0.12
70 0.15
71 0.21
72 0.22
73 0.23
74 0.25
75 0.33
76 0.41
77 0.42
78 0.47
79 0.44
80 0.44
81 0.44
82 0.49
83 0.41
84 0.32
85 0.28
86 0.2
87 0.18
88 0.17
89 0.17
90 0.09
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.08
97 0.08
98 0.09
99 0.11
100 0.11
101 0.11
102 0.13
103 0.12
104 0.12
105 0.18
106 0.18
107 0.21
108 0.2
109 0.2
110 0.19
111 0.19
112 0.18
113 0.12
114 0.11
115 0.07
116 0.13
117 0.13
118 0.13
119 0.14
120 0.21
121 0.32
122 0.37
123 0.43
124 0.42
125 0.5
126 0.54
127 0.57
128 0.59
129 0.53
130 0.49
131 0.5
132 0.54
133 0.57
134 0.62
135 0.69
136 0.71
137 0.75
138 0.83
139 0.84
140 0.85
141 0.85