Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168LLT0

Protein Details
Accession A0A168LLT0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-33DVIFQQKRPRKKFNEVERLYHydrophilic
NLS Segment(s)
PositionSequence
68-81FKELRRQLKKNRKK
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences AEEQQKIYSFVPLDVIFQQKRPRKKFNEVERLYACTYMDCTKAYGTLNHLNAHVTMQGHGPKRMPIEFKELRRQLKKNRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.23
4 0.26
5 0.35
6 0.38
7 0.48
8 0.54
9 0.61
10 0.62
11 0.72
12 0.78
13 0.79
14 0.83
15 0.75
16 0.75
17 0.66
18 0.62
19 0.52
20 0.43
21 0.32
22 0.21
23 0.2
24 0.15
25 0.14
26 0.1
27 0.11
28 0.1
29 0.12
30 0.12
31 0.11
32 0.15
33 0.19
34 0.21
35 0.21
36 0.21
37 0.2
38 0.2
39 0.19
40 0.16
41 0.11
42 0.09
43 0.12
44 0.17
45 0.19
46 0.21
47 0.22
48 0.23
49 0.26
50 0.3
51 0.31
52 0.28
53 0.35
54 0.4
55 0.46
56 0.53
57 0.57
58 0.63
59 0.68
60 0.74
61 0.75