Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168IVU7

Protein Details
Accession A0A168IVU7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-55AKIQDFKFKKFKQKALQLNPSTHydrophilic
173-201TTGRGDSLKRHKKAKHKKSADEKTTPKDRBasic
NLS Segment(s)
PositionSequence
180-200LKRHKKAKHKKSADEKTTPKD
Subcellular Location(s) nucl 11, cyto 10, mito 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MTDRLLWVIGQGMHVLNVHSINSLLSFAGFSTIAKIQDFKFKKFKQKALQLNPSTPQQAFLQTTLVHKFACDYEGCEYTATAIAILKKHKRIHDPNRKTLACNFPGCKYTALSYDKFKDHKKIHAPDFKTYAYDSPGCSYISMELAPLKRHKITHDPNANKKFDFDFPGCIFTTGRGDSLKRHKKAKHKKSADEKTTPKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.11
5 0.11
6 0.1
7 0.1
8 0.09
9 0.09
10 0.09
11 0.07
12 0.07
13 0.06
14 0.06
15 0.08
16 0.07
17 0.07
18 0.09
19 0.12
20 0.13
21 0.13
22 0.16
23 0.15
24 0.25
25 0.29
26 0.32
27 0.4
28 0.45
29 0.55
30 0.62
31 0.7
32 0.69
33 0.76
34 0.8
35 0.8
36 0.84
37 0.77
38 0.72
39 0.66
40 0.59
41 0.52
42 0.41
43 0.33
44 0.24
45 0.24
46 0.22
47 0.2
48 0.19
49 0.17
50 0.2
51 0.2
52 0.2
53 0.15
54 0.13
55 0.14
56 0.12
57 0.13
58 0.1
59 0.1
60 0.13
61 0.14
62 0.15
63 0.14
64 0.13
65 0.12
66 0.13
67 0.1
68 0.07
69 0.07
70 0.08
71 0.1
72 0.15
73 0.18
74 0.24
75 0.28
76 0.33
77 0.41
78 0.5
79 0.59
80 0.66
81 0.7
82 0.72
83 0.77
84 0.73
85 0.65
86 0.61
87 0.56
88 0.49
89 0.45
90 0.37
91 0.3
92 0.31
93 0.31
94 0.26
95 0.2
96 0.17
97 0.19
98 0.21
99 0.21
100 0.23
101 0.26
102 0.28
103 0.31
104 0.33
105 0.36
106 0.35
107 0.42
108 0.48
109 0.52
110 0.57
111 0.62
112 0.62
113 0.57
114 0.59
115 0.51
116 0.43
117 0.36
118 0.29
119 0.24
120 0.22
121 0.19
122 0.16
123 0.17
124 0.16
125 0.15
126 0.14
127 0.12
128 0.11
129 0.1
130 0.09
131 0.11
132 0.13
133 0.16
134 0.19
135 0.22
136 0.23
137 0.25
138 0.29
139 0.36
140 0.42
141 0.49
142 0.57
143 0.62
144 0.69
145 0.76
146 0.74
147 0.64
148 0.59
149 0.52
150 0.44
151 0.43
152 0.34
153 0.33
154 0.32
155 0.35
156 0.33
157 0.3
158 0.27
159 0.22
160 0.25
161 0.19
162 0.2
163 0.19
164 0.2
165 0.26
166 0.38
167 0.46
168 0.47
169 0.55
170 0.61
171 0.69
172 0.8
173 0.83
174 0.83
175 0.83
176 0.88
177 0.9
178 0.94
179 0.91
180 0.9
181 0.87