Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168KE03

Protein Details
Accession A0A168KE03    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-35DEDDGEKKPQRRSGRRKIKIEYIEBasic
NLS Segment(s)
PositionSequence
18-33KKPQRRSGRRKIKIEY
36-48DKTRRHITFSKRK
Subcellular Location(s) nucl 22, cyto 3.5, cyto_pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033897  MADS_SRF-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000987  F:cis-regulatory region sequence-specific DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS00350  MADS_BOX_1  
PS50066  MADS_BOX_2  
CDD cd00266  MADS_SRF_like  
Amino Acid Sequences MDNGQDGLDDEDEDDGEKKPQRRSGRRKIKIEYIEDKTRRHITFSKRKAGIMKKAYELSTLTGTQVLLLVVSETGLVYTFTTPKLQPLVTKPEGKNLIQSCLNAPDASMENGSLNGSPSMVSLRVSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.14
4 0.19
5 0.24
6 0.3
7 0.39
8 0.49
9 0.59
10 0.68
11 0.75
12 0.81
13 0.85
14 0.87
15 0.84
16 0.83
17 0.79
18 0.76
19 0.73
20 0.68
21 0.69
22 0.64
23 0.59
24 0.56
25 0.56
26 0.49
27 0.46
28 0.45
29 0.46
30 0.53
31 0.58
32 0.62
33 0.56
34 0.57
35 0.6
36 0.6
37 0.59
38 0.55
39 0.5
40 0.44
41 0.45
42 0.43
43 0.36
44 0.3
45 0.22
46 0.18
47 0.15
48 0.13
49 0.11
50 0.1
51 0.09
52 0.08
53 0.06
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02
62 0.03
63 0.03
64 0.04
65 0.05
66 0.06
67 0.07
68 0.09
69 0.09
70 0.11
71 0.14
72 0.14
73 0.16
74 0.2
75 0.28
76 0.31
77 0.39
78 0.37
79 0.43
80 0.46
81 0.43
82 0.47
83 0.39
84 0.4
85 0.34
86 0.34
87 0.28
88 0.28
89 0.29
90 0.21
91 0.19
92 0.17
93 0.17
94 0.18
95 0.16
96 0.13
97 0.12
98 0.13
99 0.14
100 0.11
101 0.11
102 0.09
103 0.09
104 0.08
105 0.09
106 0.11
107 0.11