Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162Z0B0

Protein Details
Accession A0A162Z0B0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
115-142VTAASSRPRKPRNTEPKRKKVIVKRMLTHydrophilic
NLS Segment(s)
PositionSequence
120-136SRPRKPRNTEPKRKKVI
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
IPR036887  HTH_APSES_sf  
IPR018004  KilA/APSES_HTH  
IPR003163  Tscrpt_reg_HTH_APSES-type  
Gene Ontology GO:0090575  C:RNA polymerase II transcription regulator complex  
GO:0003677  F:DNA binding  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000083  P:regulation of transcription involved in G1/S transition of mitotic cell cycle  
Pfam View protein in Pfam  
PF13637  Ank_4  
PF04383  KilA-N  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
PS51299  HTH_APSES  
Amino Acid Sequences MAQIYKATYSGVPVYEFNCNNVAVMRRRSDSYLNATQILKVAEFDKPQRTRILEREVQTGQHEKVQGGYGKYQGTWVPFERGVALAEHYHVDTILRPIFDYVRGDVSPPLAPKHVTAASSRPRKPRNTEPKRKKVIVKRMLTEEDMDIDLSYHHDFNNAAFTEQFFADNVHNNSSSSNNNNKRPRPLDNFADHDMDMAHDRSYAQKLLQYFISDDNGIPAILLRPPADLDVNVIIDDEGHTSLHWAAAMGRLKLVSILIDLGADIYRVNYKGQTALMRSVLFTNNFDAKSFLFLIDMLKKTIFNIDKKDQTVFHHVAATASWKGKVHASRYYMECLIETLANNQSELISILNVQDVYGDTALSIAARIGNKKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.27
4 0.26
5 0.26
6 0.24
7 0.23
8 0.24
9 0.29
10 0.28
11 0.34
12 0.36
13 0.37
14 0.39
15 0.43
16 0.45
17 0.44
18 0.45
19 0.47
20 0.44
21 0.45
22 0.43
23 0.39
24 0.37
25 0.32
26 0.24
27 0.18
28 0.17
29 0.17
30 0.21
31 0.26
32 0.33
33 0.35
34 0.37
35 0.43
36 0.46
37 0.48
38 0.52
39 0.56
40 0.52
41 0.52
42 0.56
43 0.51
44 0.48
45 0.45
46 0.42
47 0.34
48 0.32
49 0.31
50 0.25
51 0.25
52 0.28
53 0.28
54 0.25
55 0.27
56 0.26
57 0.25
58 0.25
59 0.25
60 0.22
61 0.21
62 0.23
63 0.22
64 0.24
65 0.23
66 0.23
67 0.22
68 0.21
69 0.19
70 0.15
71 0.15
72 0.11
73 0.11
74 0.12
75 0.11
76 0.1
77 0.09
78 0.09
79 0.08
80 0.12
81 0.13
82 0.12
83 0.13
84 0.14
85 0.15
86 0.17
87 0.18
88 0.15
89 0.16
90 0.16
91 0.17
92 0.17
93 0.18
94 0.18
95 0.17
96 0.18
97 0.16
98 0.16
99 0.16
100 0.2
101 0.2
102 0.18
103 0.19
104 0.25
105 0.33
106 0.41
107 0.46
108 0.5
109 0.55
110 0.61
111 0.67
112 0.7
113 0.73
114 0.75
115 0.81
116 0.83
117 0.86
118 0.88
119 0.86
120 0.84
121 0.83
122 0.82
123 0.81
124 0.76
125 0.69
126 0.66
127 0.62
128 0.54
129 0.45
130 0.34
131 0.26
132 0.2
133 0.16
134 0.11
135 0.08
136 0.07
137 0.08
138 0.09
139 0.07
140 0.07
141 0.08
142 0.08
143 0.08
144 0.14
145 0.12
146 0.12
147 0.11
148 0.12
149 0.12
150 0.12
151 0.12
152 0.07
153 0.08
154 0.09
155 0.14
156 0.15
157 0.15
158 0.15
159 0.15
160 0.15
161 0.16
162 0.17
163 0.17
164 0.26
165 0.3
166 0.39
167 0.46
168 0.49
169 0.54
170 0.56
171 0.58
172 0.57
173 0.55
174 0.53
175 0.49
176 0.5
177 0.45
178 0.43
179 0.35
180 0.27
181 0.22
182 0.16
183 0.14
184 0.1
185 0.08
186 0.06
187 0.07
188 0.09
189 0.11
190 0.11
191 0.1
192 0.11
193 0.12
194 0.13
195 0.14
196 0.13
197 0.12
198 0.12
199 0.13
200 0.12
201 0.11
202 0.1
203 0.1
204 0.09
205 0.07
206 0.06
207 0.06
208 0.06
209 0.07
210 0.07
211 0.07
212 0.07
213 0.08
214 0.09
215 0.08
216 0.09
217 0.09
218 0.09
219 0.09
220 0.08
221 0.07
222 0.06
223 0.07
224 0.06
225 0.05
226 0.05
227 0.05
228 0.06
229 0.07
230 0.07
231 0.06
232 0.05
233 0.05
234 0.11
235 0.14
236 0.13
237 0.13
238 0.13
239 0.13
240 0.13
241 0.13
242 0.07
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.04
251 0.04
252 0.05
253 0.07
254 0.08
255 0.09
256 0.09
257 0.1
258 0.12
259 0.15
260 0.17
261 0.18
262 0.2
263 0.22
264 0.21
265 0.21
266 0.22
267 0.22
268 0.2
269 0.19
270 0.2
271 0.22
272 0.22
273 0.22
274 0.21
275 0.18
276 0.2
277 0.19
278 0.15
279 0.11
280 0.11
281 0.15
282 0.19
283 0.2
284 0.18
285 0.18
286 0.18
287 0.18
288 0.26
289 0.28
290 0.27
291 0.34
292 0.4
293 0.46
294 0.48
295 0.5
296 0.44
297 0.44
298 0.48
299 0.43
300 0.37
301 0.33
302 0.32
303 0.29
304 0.27
305 0.26
306 0.21
307 0.2
308 0.21
309 0.18
310 0.2
311 0.26
312 0.31
313 0.32
314 0.36
315 0.38
316 0.42
317 0.44
318 0.48
319 0.43
320 0.38
321 0.33
322 0.26
323 0.24
324 0.2
325 0.17
326 0.16
327 0.2
328 0.2
329 0.19
330 0.18
331 0.17
332 0.15
333 0.15
334 0.12
335 0.08
336 0.08
337 0.08
338 0.1
339 0.1
340 0.09
341 0.09
342 0.1
343 0.12
344 0.12
345 0.11
346 0.09
347 0.09
348 0.09
349 0.08
350 0.08
351 0.05
352 0.09
353 0.12
354 0.15