Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168H4C4

Protein Details
Accession A0A168H4C4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-33QSTLNLPKNRRNTRQQQKLKSVHDESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MPPKKQGQSTLNLPKNRRNTRQQQKLKSVHDESIIQIGTHQEPQQTKATSNKPEIHQEHLDETDKLLRAFDLNYAFGPCVGIKRLDRWERAYNLGLDPPTSIKDILVKNKTGKYAESVFHQFRMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.74
4 0.72
5 0.71
6 0.74
7 0.79
8 0.86
9 0.87
10 0.86
11 0.87
12 0.88
13 0.83
14 0.8
15 0.73
16 0.64
17 0.56
18 0.48
19 0.38
20 0.34
21 0.29
22 0.2
23 0.17
24 0.16
25 0.15
26 0.16
27 0.16
28 0.15
29 0.16
30 0.2
31 0.25
32 0.24
33 0.25
34 0.29
35 0.35
36 0.36
37 0.41
38 0.42
39 0.38
40 0.46
41 0.46
42 0.44
43 0.4
44 0.36
45 0.32
46 0.29
47 0.28
48 0.2
49 0.18
50 0.16
51 0.15
52 0.13
53 0.12
54 0.09
55 0.09
56 0.09
57 0.11
58 0.1
59 0.1
60 0.1
61 0.11
62 0.11
63 0.1
64 0.1
65 0.08
66 0.08
67 0.08
68 0.11
69 0.11
70 0.16
71 0.25
72 0.3
73 0.33
74 0.38
75 0.44
76 0.43
77 0.46
78 0.44
79 0.37
80 0.33
81 0.33
82 0.27
83 0.2
84 0.19
85 0.16
86 0.15
87 0.15
88 0.14
89 0.11
90 0.17
91 0.23
92 0.31
93 0.34
94 0.37
95 0.42
96 0.45
97 0.5
98 0.45
99 0.41
100 0.38
101 0.38
102 0.36
103 0.37
104 0.41
105 0.39