Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168JEG7

Protein Details
Accession A0A168JEG7    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23PRKNASATPRKKRDPNAPKGPGNHydrophilic
NLS Segment(s)
PositionSequence
10-13RKKR
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences PRKNASATPRKKRDPNAPKGPGNVFFLYCRMERDNIKDEVPNESLGEVTRLLGQKWKALTKDQKQKYYDIYKKEQDEYEVAMKSYTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.83
4 0.81
5 0.76
6 0.73
7 0.69
8 0.61
9 0.55
10 0.45
11 0.35
12 0.28
13 0.26
14 0.24
15 0.21
16 0.21
17 0.18
18 0.19
19 0.2
20 0.26
21 0.29
22 0.28
23 0.29
24 0.27
25 0.26
26 0.27
27 0.26
28 0.2
29 0.15
30 0.14
31 0.13
32 0.11
33 0.11
34 0.06
35 0.06
36 0.08
37 0.09
38 0.09
39 0.13
40 0.14
41 0.16
42 0.19
43 0.23
44 0.22
45 0.29
46 0.39
47 0.45
48 0.55
49 0.59
50 0.64
51 0.62
52 0.64
53 0.64
54 0.66
55 0.62
56 0.59
57 0.59
58 0.59
59 0.61
60 0.62
61 0.55
62 0.48
63 0.44
64 0.41
65 0.39
66 0.33
67 0.29