Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168JYA8

Protein Details
Accession A0A168JYA8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-46YLVIPKRDRAHHQKKSKRTKPCKTCVFLGSHydrophilic
NLS Segment(s)
PositionSequence
24-34DRAHHQKKSKR
Subcellular Location(s) plas 17, E.R. 7, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013969  Oligosacch_biosynth_Alg14  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031965  C:nuclear membrane  
GO:0016740  F:transferase activity  
GO:0006488  P:dolichol-linked oligosaccharide biosynthetic process  
Pfam View protein in Pfam  
PF08660  Alg14  
Amino Acid Sequences MILVIVALIVLAITRVYLVIPKRDRAHHQKKSKRTKPCKTCVFLGSGGHTGEMLQLMKSLNSSHYYPRTYIVTNTDSLSKEKAIAYEQSTGQQNDFNIYTIPRAREMGQPWSRVPLTVLAALVASVKIIVTAWPDLIVCNGPGSCIPVCMLAYIPRVLGIKKMEIIYIESFARVESLSITGKLLYPFVDRFLVQWPQLSNMFDKAEYRGILV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.09
5 0.12
6 0.21
7 0.26
8 0.32
9 0.38
10 0.43
11 0.53
12 0.59
13 0.68
14 0.68
15 0.76
16 0.79
17 0.85
18 0.9
19 0.9
20 0.9
21 0.9
22 0.9
23 0.9
24 0.91
25 0.9
26 0.83
27 0.8
28 0.72
29 0.65
30 0.57
31 0.48
32 0.4
33 0.33
34 0.28
35 0.22
36 0.19
37 0.14
38 0.12
39 0.12
40 0.09
41 0.06
42 0.07
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.12
49 0.14
50 0.18
51 0.23
52 0.25
53 0.25
54 0.27
55 0.28
56 0.26
57 0.26
58 0.25
59 0.22
60 0.21
61 0.21
62 0.22
63 0.21
64 0.21
65 0.2
66 0.16
67 0.15
68 0.14
69 0.15
70 0.13
71 0.14
72 0.16
73 0.17
74 0.17
75 0.18
76 0.21
77 0.2
78 0.19
79 0.18
80 0.15
81 0.14
82 0.14
83 0.11
84 0.09
85 0.09
86 0.11
87 0.12
88 0.13
89 0.12
90 0.12
91 0.14
92 0.18
93 0.19
94 0.27
95 0.28
96 0.3
97 0.29
98 0.31
99 0.29
100 0.25
101 0.24
102 0.16
103 0.14
104 0.13
105 0.12
106 0.09
107 0.09
108 0.08
109 0.08
110 0.05
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.06
126 0.07
127 0.06
128 0.06
129 0.07
130 0.1
131 0.09
132 0.09
133 0.09
134 0.1
135 0.1
136 0.1
137 0.11
138 0.1
139 0.12
140 0.12
141 0.12
142 0.12
143 0.13
144 0.13
145 0.16
146 0.15
147 0.15
148 0.18
149 0.18
150 0.17
151 0.17
152 0.2
153 0.17
154 0.18
155 0.16
156 0.14
157 0.13
158 0.12
159 0.12
160 0.09
161 0.08
162 0.06
163 0.09
164 0.1
165 0.11
166 0.12
167 0.12
168 0.14
169 0.14
170 0.14
171 0.12
172 0.15
173 0.15
174 0.17
175 0.19
176 0.17
177 0.17
178 0.22
179 0.26
180 0.23
181 0.26
182 0.24
183 0.26
184 0.29
185 0.3
186 0.26
187 0.26
188 0.27
189 0.25
190 0.25
191 0.25
192 0.26