Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168HQU7

Protein Details
Accession A0A168HQU7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23GKRKTKRKPQKKLKDKLDTQFNCBasic
NLS Segment(s)
PositionSequence
2-14KRKTKRKPQKKLK
Subcellular Location(s) cyto_nucl 9.666, nucl 9.5, mito_nucl 8.999, cyto_mito 7.999, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences GKRKTKRKPQKKLKDKLDTQFNCLFCNHENSIECKIDSPNKVGILTCKICSVSWQCPVTYLDEPVDVYSAWIDACEDVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.91
3 0.88
4 0.87
5 0.78
6 0.73
7 0.68
8 0.58
9 0.49
10 0.41
11 0.35
12 0.25
13 0.29
14 0.24
15 0.22
16 0.22
17 0.24
18 0.29
19 0.27
20 0.25
21 0.2
22 0.22
23 0.23
24 0.23
25 0.23
26 0.21
27 0.2
28 0.21
29 0.2
30 0.19
31 0.2
32 0.2
33 0.18
34 0.17
35 0.17
36 0.16
37 0.2
38 0.23
39 0.22
40 0.28
41 0.29
42 0.28
43 0.3
44 0.31
45 0.32
46 0.28
47 0.25
48 0.19
49 0.18
50 0.19
51 0.17
52 0.17
53 0.12
54 0.1
55 0.09
56 0.08
57 0.07
58 0.06
59 0.07