Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162R2Y4

Protein Details
Accession A0A162R2Y4    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
127-151INNRQLKYLENYKRRKRSSVSCCISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10cyto_nucl 10, cyto 8, mito 4, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR000242  PTP_cat  
IPR000387  Tyr_Pase_dom  
Gene Ontology GO:0004725  F:protein tyrosine phosphatase activity  
GO:0006470  P:protein dephosphorylation  
Pfam View protein in Pfam  
PF00102  Y_phosphatase  
PROSITE View protein in PROSITE  
PS50056  TYR_PHOSPHATASE_2  
CDD cd14500  PTP-IVa  
Amino Acid Sequences MSRYIKEFERWNVTDVVRCCEATYSQTLLNQHGIQVHDWTFSDGAPPPKCVIDEWLDLIEVRFKHSDKDTDDHFYNVLDKQQQPCIAAHCVAGLGRAPVLVAIALIEEGMEPLDSIAFIRSLRKGSINNRQLKYLENYKRRKRSSVSCCIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.38
4 0.31
5 0.3
6 0.27
7 0.24
8 0.24
9 0.21
10 0.23
11 0.21
12 0.2
13 0.23
14 0.24
15 0.24
16 0.27
17 0.23
18 0.2
19 0.21
20 0.21
21 0.18
22 0.2
23 0.18
24 0.15
25 0.15
26 0.16
27 0.13
28 0.12
29 0.13
30 0.14
31 0.2
32 0.2
33 0.22
34 0.21
35 0.22
36 0.22
37 0.21
38 0.21
39 0.17
40 0.17
41 0.17
42 0.16
43 0.16
44 0.15
45 0.15
46 0.15
47 0.11
48 0.12
49 0.12
50 0.12
51 0.15
52 0.17
53 0.22
54 0.22
55 0.24
56 0.24
57 0.27
58 0.27
59 0.25
60 0.23
61 0.18
62 0.16
63 0.14
64 0.14
65 0.12
66 0.14
67 0.15
68 0.18
69 0.19
70 0.19
71 0.19
72 0.2
73 0.19
74 0.17
75 0.15
76 0.12
77 0.11
78 0.1
79 0.09
80 0.07
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.02
90 0.03
91 0.03
92 0.03
93 0.03
94 0.02
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.04
104 0.05
105 0.06
106 0.09
107 0.11
108 0.14
109 0.15
110 0.19
111 0.25
112 0.32
113 0.43
114 0.49
115 0.57
116 0.56
117 0.58
118 0.55
119 0.53
120 0.52
121 0.52
122 0.53
123 0.54
124 0.63
125 0.7
126 0.79
127 0.8
128 0.81
129 0.79
130 0.79
131 0.79