Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162QFQ1

Protein Details
Accession A0A162QFQ1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
82-101LAMIKKRRKAEGVKERKKACBasic
NLS Segment(s)
PositionSequence
86-99KKRRKAEGVKERKK
Subcellular Location(s) mito 10.5, cyto_mito 9.5, nucl 9, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSANNFNKVEICMGCYCGYLAGKYRAPSEKDPTCLDAAWKENHHSLDVAFRKYYHQVDEAQGAVTTPGRCGISRAMPEDEALAMIKKRRKAEGVKERKKACLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.17
5 0.17
6 0.14
7 0.18
8 0.2
9 0.23
10 0.24
11 0.29
12 0.31
13 0.35
14 0.39
15 0.42
16 0.41
17 0.42
18 0.43
19 0.4
20 0.36
21 0.32
22 0.28
23 0.23
24 0.22
25 0.22
26 0.21
27 0.21
28 0.23
29 0.23
30 0.22
31 0.19
32 0.16
33 0.21
34 0.22
35 0.22
36 0.19
37 0.18
38 0.2
39 0.23
40 0.24
41 0.18
42 0.16
43 0.17
44 0.18
45 0.19
46 0.18
47 0.15
48 0.13
49 0.11
50 0.1
51 0.1
52 0.09
53 0.07
54 0.09
55 0.1
56 0.1
57 0.12
58 0.15
59 0.19
60 0.21
61 0.25
62 0.25
63 0.24
64 0.24
65 0.23
66 0.2
67 0.15
68 0.13
69 0.11
70 0.1
71 0.16
72 0.21
73 0.26
74 0.29
75 0.34
76 0.41
77 0.48
78 0.58
79 0.63
80 0.7
81 0.75
82 0.8
83 0.78