Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4W7V7

Protein Details
Accession J4W7V7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
293-318DTRHHYRATKAGKKSKPKFPAAWRMTHydrophilic
NLS Segment(s)
PositionSequence
301-321TKAGKKSKPKFPAAWRMTAKR
382-385RARR
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR039848  Ribosomal_S24/S35  
IPR019349  Ribosomal_S24/S35_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF10213  MRP-S28  
Amino Acid Sequences MASAPRVARLCAAACRRAVPQLAQHRVMTMAGPRAAVAFSTSTMRAAERTFDGDEGGESAPVELKELDKAFMDRATPEGLRQLDQLAKLNGHNSIEAYLDDKLRYTAGFSTQDKLLTDELVVEDSPAKPDYKAFWYDEDDPDTFSEEHDEFKEDDMMSMAHNKLKEIREMRQYTRLAVWEMPLLSKLAKPFELPKEDHVLRWRYTTYMGEAHPAESKVVVQFAPQDLGLTEVQTDKLRKLAGARLNPETDVIKMSSGRFEHQAQNKRYLQQLVGALVAEAKDPRDTFADVALDTRHHYRATKAGKKSKPKFPAAWRMTAKRRTELAELRAQAGRAEAQRLDEGRVVDGQQKIDGYLMQRLAEEQAKAAAEPVPVPAGRGPARARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.37
4 0.39
5 0.4
6 0.35
7 0.38
8 0.44
9 0.5
10 0.5
11 0.48
12 0.44
13 0.42
14 0.38
15 0.31
16 0.25
17 0.23
18 0.21
19 0.2
20 0.19
21 0.19
22 0.18
23 0.17
24 0.14
25 0.09
26 0.1
27 0.13
28 0.13
29 0.13
30 0.14
31 0.15
32 0.15
33 0.15
34 0.17
35 0.16
36 0.19
37 0.19
38 0.19
39 0.19
40 0.17
41 0.16
42 0.15
43 0.13
44 0.1
45 0.09
46 0.09
47 0.11
48 0.1
49 0.11
50 0.09
51 0.1
52 0.14
53 0.15
54 0.16
55 0.15
56 0.16
57 0.16
58 0.17
59 0.17
60 0.13
61 0.14
62 0.17
63 0.16
64 0.16
65 0.2
66 0.2
67 0.2
68 0.2
69 0.21
70 0.21
71 0.22
72 0.26
73 0.22
74 0.22
75 0.22
76 0.23
77 0.22
78 0.2
79 0.18
80 0.14
81 0.14
82 0.13
83 0.12
84 0.12
85 0.12
86 0.12
87 0.12
88 0.12
89 0.11
90 0.11
91 0.11
92 0.11
93 0.11
94 0.14
95 0.2
96 0.21
97 0.23
98 0.24
99 0.25
100 0.24
101 0.24
102 0.2
103 0.14
104 0.13
105 0.11
106 0.1
107 0.1
108 0.09
109 0.07
110 0.08
111 0.08
112 0.1
113 0.1
114 0.1
115 0.1
116 0.11
117 0.14
118 0.17
119 0.21
120 0.21
121 0.23
122 0.27
123 0.3
124 0.31
125 0.31
126 0.27
127 0.24
128 0.22
129 0.23
130 0.18
131 0.14
132 0.16
133 0.12
134 0.13
135 0.13
136 0.15
137 0.12
138 0.13
139 0.16
140 0.12
141 0.12
142 0.11
143 0.11
144 0.09
145 0.12
146 0.12
147 0.11
148 0.11
149 0.11
150 0.17
151 0.18
152 0.24
153 0.24
154 0.28
155 0.36
156 0.4
157 0.42
158 0.45
159 0.44
160 0.39
161 0.37
162 0.34
163 0.26
164 0.22
165 0.2
166 0.13
167 0.13
168 0.11
169 0.1
170 0.09
171 0.08
172 0.09
173 0.09
174 0.09
175 0.1
176 0.1
177 0.15
178 0.2
179 0.24
180 0.23
181 0.24
182 0.3
183 0.3
184 0.31
185 0.32
186 0.31
187 0.27
188 0.28
189 0.27
190 0.2
191 0.21
192 0.2
193 0.17
194 0.16
195 0.16
196 0.17
197 0.16
198 0.16
199 0.16
200 0.16
201 0.13
202 0.1
203 0.1
204 0.08
205 0.09
206 0.08
207 0.06
208 0.08
209 0.08
210 0.09
211 0.08
212 0.08
213 0.07
214 0.1
215 0.09
216 0.08
217 0.08
218 0.07
219 0.09
220 0.11
221 0.12
222 0.1
223 0.12
224 0.12
225 0.13
226 0.15
227 0.21
228 0.25
229 0.3
230 0.33
231 0.34
232 0.34
233 0.34
234 0.32
235 0.26
236 0.2
237 0.16
238 0.13
239 0.11
240 0.11
241 0.12
242 0.15
243 0.15
244 0.16
245 0.18
246 0.21
247 0.28
248 0.35
249 0.44
250 0.42
251 0.5
252 0.52
253 0.51
254 0.51
255 0.46
256 0.38
257 0.33
258 0.32
259 0.24
260 0.21
261 0.19
262 0.15
263 0.13
264 0.12
265 0.08
266 0.07
267 0.07
268 0.09
269 0.09
270 0.11
271 0.13
272 0.14
273 0.14
274 0.16
275 0.16
276 0.14
277 0.15
278 0.14
279 0.13
280 0.14
281 0.16
282 0.16
283 0.16
284 0.17
285 0.19
286 0.27
287 0.37
288 0.43
289 0.5
290 0.58
291 0.65
292 0.75
293 0.81
294 0.82
295 0.8
296 0.79
297 0.78
298 0.78
299 0.8
300 0.74
301 0.75
302 0.72
303 0.71
304 0.73
305 0.73
306 0.67
307 0.62
308 0.6
309 0.55
310 0.57
311 0.55
312 0.51
313 0.51
314 0.48
315 0.45
316 0.44
317 0.4
318 0.32
319 0.26
320 0.25
321 0.19
322 0.22
323 0.19
324 0.2
325 0.25
326 0.26
327 0.27
328 0.26
329 0.24
330 0.22
331 0.23
332 0.22
333 0.23
334 0.25
335 0.23
336 0.22
337 0.21
338 0.2
339 0.19
340 0.2
341 0.17
342 0.2
343 0.21
344 0.19
345 0.19
346 0.2
347 0.23
348 0.24
349 0.22
350 0.17
351 0.19
352 0.19
353 0.19
354 0.19
355 0.18
356 0.15
357 0.15
358 0.16
359 0.17
360 0.16
361 0.18
362 0.19
363 0.23
364 0.24
365 0.3