Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162Q808

Protein Details
Accession A0A162Q808    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
166-196AKKEAADKKKITKKRKSKKCRDFEKAVKAGKBasic
NLS Segment(s)
PositionSequence
167-203KKEAADKKKITKKRKSKKCRDFEKAVKAGKIKADPKM
232-265KKRDSGARGGFRGRGGSRGGSRGGMMAGRGRGRA
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MKFENKVSGRAKSQVHTEVQSSVRNEIFEQESMDEEVVKEEAERMDILMRNLIGNADGNEEEEESKEEESNDMETEQAEEFSFRLFASEPVATVTIAEGADNTDDLSKAIADQQVYEFDETDPEFFAKVEQAAIDYDTILTQSKIPYPTATFPRRILHLLSPEEQAKKEAADKKKITKKRKSKKCRDFEKAVKAGKIKADPKMRNPATPDGWPGWPGNLTRIAIINYQPSNKKRDSGARGGFRGRGGSRGGSRGGMMAGRGRGRAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.43
4 0.41
5 0.39
6 0.38
7 0.41
8 0.36
9 0.33
10 0.3
11 0.29
12 0.27
13 0.26
14 0.26
15 0.22
16 0.22
17 0.18
18 0.19
19 0.19
20 0.19
21 0.15
22 0.12
23 0.12
24 0.1
25 0.09
26 0.08
27 0.08
28 0.09
29 0.1
30 0.1
31 0.09
32 0.13
33 0.15
34 0.16
35 0.16
36 0.16
37 0.15
38 0.15
39 0.14
40 0.11
41 0.1
42 0.1
43 0.1
44 0.1
45 0.11
46 0.11
47 0.12
48 0.11
49 0.11
50 0.12
51 0.1
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.12
58 0.11
59 0.1
60 0.09
61 0.08
62 0.1
63 0.09
64 0.09
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.06
71 0.06
72 0.07
73 0.07
74 0.1
75 0.1
76 0.09
77 0.1
78 0.11
79 0.1
80 0.09
81 0.09
82 0.07
83 0.06
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.04
91 0.04
92 0.05
93 0.05
94 0.04
95 0.05
96 0.07
97 0.08
98 0.08
99 0.08
100 0.09
101 0.11
102 0.12
103 0.12
104 0.1
105 0.08
106 0.1
107 0.1
108 0.09
109 0.08
110 0.07
111 0.07
112 0.06
113 0.07
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.05
122 0.05
123 0.05
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.09
131 0.11
132 0.11
133 0.12
134 0.14
135 0.18
136 0.25
137 0.28
138 0.28
139 0.29
140 0.31
141 0.32
142 0.31
143 0.29
144 0.24
145 0.27
146 0.27
147 0.26
148 0.27
149 0.28
150 0.28
151 0.25
152 0.23
153 0.17
154 0.15
155 0.2
156 0.26
157 0.29
158 0.37
159 0.41
160 0.5
161 0.59
162 0.67
163 0.71
164 0.74
165 0.79
166 0.8
167 0.88
168 0.89
169 0.91
170 0.93
171 0.93
172 0.93
173 0.9
174 0.89
175 0.87
176 0.86
177 0.82
178 0.75
179 0.68
180 0.6
181 0.55
182 0.5
183 0.48
184 0.42
185 0.42
186 0.48
187 0.49
188 0.54
189 0.62
190 0.59
191 0.55
192 0.56
193 0.55
194 0.49
195 0.46
196 0.44
197 0.36
198 0.35
199 0.33
200 0.28
201 0.23
202 0.22
203 0.2
204 0.19
205 0.21
206 0.2
207 0.19
208 0.21
209 0.21
210 0.2
211 0.22
212 0.25
213 0.23
214 0.28
215 0.35
216 0.36
217 0.41
218 0.41
219 0.43
220 0.43
221 0.5
222 0.53
223 0.55
224 0.61
225 0.62
226 0.64
227 0.64
228 0.61
229 0.52
230 0.51
231 0.41
232 0.35
233 0.31
234 0.32
235 0.33
236 0.34
237 0.34
238 0.28
239 0.28
240 0.25
241 0.24
242 0.18
243 0.16
244 0.17
245 0.21
246 0.22