Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168LTH0

Protein Details
Accession A0A168LTH0    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-52EISKRSRADKIKNSNRNTLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, plas 1, pero 1, golg 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR038887  Nus1/NgBR  
IPR036424  UPP_synth-like_sf  
Gene Ontology GO:1904423  C:dehydrodolichyl diphosphate synthase complex  
GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0019408  P:dolichol biosynthetic process  
Amino Acid Sequences MTTVLTETADQPILQLNTTKYISNINTTETSAEISKRSRADKIKNSNRNTLSHVFLTAILYTLHFIYISFIAFKSLYSYLENLLRDTHQHPHDIHQRIQFDKTQLTKIPEHLTINVSRELASTRSCKEWEKLMYDISMSTCWAWDFGIKEVSVYDASGIMKSVSVDLYKQQSTILHDYMIKYNKGEKIRPALKFSILSIENGKQHMGRVVQEMAKDYPDTIDIPLVDHGLCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.18
4 0.23
5 0.25
6 0.25
7 0.2
8 0.26
9 0.26
10 0.29
11 0.28
12 0.27
13 0.27
14 0.28
15 0.27
16 0.21
17 0.22
18 0.17
19 0.18
20 0.17
21 0.18
22 0.23
23 0.26
24 0.29
25 0.35
26 0.42
27 0.5
28 0.57
29 0.66
30 0.72
31 0.77
32 0.79
33 0.8
34 0.75
35 0.68
36 0.64
37 0.57
38 0.49
39 0.41
40 0.36
41 0.27
42 0.24
43 0.22
44 0.16
45 0.13
46 0.09
47 0.08
48 0.08
49 0.08
50 0.07
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.08
57 0.07
58 0.09
59 0.09
60 0.09
61 0.1
62 0.11
63 0.11
64 0.12
65 0.13
66 0.13
67 0.17
68 0.17
69 0.15
70 0.15
71 0.14
72 0.16
73 0.17
74 0.22
75 0.2
76 0.23
77 0.23
78 0.29
79 0.38
80 0.39
81 0.41
82 0.39
83 0.41
84 0.39
85 0.41
86 0.36
87 0.29
88 0.29
89 0.27
90 0.25
91 0.25
92 0.27
93 0.26
94 0.26
95 0.27
96 0.25
97 0.24
98 0.22
99 0.22
100 0.19
101 0.2
102 0.19
103 0.16
104 0.13
105 0.13
106 0.12
107 0.12
108 0.12
109 0.13
110 0.13
111 0.15
112 0.17
113 0.18
114 0.19
115 0.23
116 0.24
117 0.25
118 0.25
119 0.23
120 0.22
121 0.2
122 0.19
123 0.14
124 0.11
125 0.08
126 0.07
127 0.06
128 0.06
129 0.06
130 0.06
131 0.07
132 0.08
133 0.09
134 0.12
135 0.11
136 0.11
137 0.11
138 0.12
139 0.11
140 0.09
141 0.08
142 0.07
143 0.08
144 0.08
145 0.08
146 0.06
147 0.06
148 0.07
149 0.07
150 0.06
151 0.07
152 0.07
153 0.1
154 0.15
155 0.15
156 0.15
157 0.16
158 0.17
159 0.22
160 0.26
161 0.23
162 0.2
163 0.21
164 0.23
165 0.29
166 0.31
167 0.26
168 0.23
169 0.28
170 0.33
171 0.37
172 0.38
173 0.38
174 0.44
175 0.51
176 0.53
177 0.53
178 0.5
179 0.48
180 0.46
181 0.41
182 0.38
183 0.31
184 0.29
185 0.28
186 0.29
187 0.28
188 0.28
189 0.29
190 0.21
191 0.22
192 0.25
193 0.23
194 0.21
195 0.22
196 0.25
197 0.26
198 0.27
199 0.29
200 0.26
201 0.26
202 0.24
203 0.2
204 0.17
205 0.17
206 0.17
207 0.14
208 0.16
209 0.14
210 0.15
211 0.16
212 0.16